|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric Unit (1, 3)
|
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3HIP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3HIP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3HIP) |
PROSITE Motifs (1, 3)
Asymmetric Unit (1, 3)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3HIP) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:82 aligned with HIP_MARPU | P59860 from UniProtKB/Swiss-Prot Length:82 Alignment length:82 10 20 30 40 50 60 70 80 HIP_MARPU 1 VPANAVTESDPAAVALKYHRDAASSERVAAARPGLPPEEQHCENCQFMNPDSAAADWKGCQLFPGKLINLSGWCASWTLRAG 82 SCOP domains d3hipa_ A: HIPIP (high potential iron protein) SCOP domains CATH domains 3hipA00 A:102-183 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains ---------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: A:102-183 UniProt: 1-82 PROSITE Transcript ---------------------------------------------------------------------------------- Transcript 3hip A 102 VPANAVTESDPAAVALKYHRDAASSERVAAARPGLPPEEQHCENCQFMNPDSAAADWKGCQLFPGKLINLSGWCASWTLRAG 183 111 121 131 141 151 161 171 181 Chain B from PDB Type:PROTEIN Length:80 aligned with HIP_MARPU | P59860 from UniProtKB/Swiss-Prot Length:82 Alignment length:80 10 20 30 40 50 60 70 80 HIP_MARPU 1 VPANAVTESDPAAVALKYHRDAASSERVAAARPGLPPEEQHCENCQFMNPDSAAADWKGCQLFPGKLINLSGWCASWTLR 80 SCOP domains d3hipb_ B: HIPIP (high potential iron protein) SCOP domains CATH domains 3hipB00 B:102-181 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: B:102-181 UniProt: 1-82 PROSITE Transcript -------------------------------------------------------------------------------- Transcript 3hip B 102 VPANAVTESDPAAVALKYHRDAASSERVAAARPGLPPEEQHCENCQFMNPDSAAADWKGCQLFPGKLINLSGWCASWTLR 181 111 121 131 141 151 161 171 181 Chain C from PDB Type:PROTEIN Length:82 aligned with HIP_MARPU | P59860 from UniProtKB/Swiss-Prot Length:82 Alignment length:82 10 20 30 40 50 60 70 80 HIP_MARPU 1 VPANAVTESDPAAVALKYHRDAASSERVAAARPGLPPEEQHCENCQFMNPDSAAADWKGCQLFPGKLINLSGWCASWTLRAG 82 SCOP domains d3hipc_ C: HIPIP (high potential iron protein) SCOP domains CATH domains 3hipC00 C:102-183 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains ---------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: C:102-183 UniProt: 1-82 PROSITE Transcript ---------------------------------------------------------------------------------- Transcript 3hip C 102 VPANAVTESDPAAVALKYHRDAASSERVAAARPGLPPEEQHCENCQFMNPDSAAADWKGCQLFPGKLINLSGWCASWTLRAG 183 111 121 131 141 151 161 171 181
|
||||||||||||||||||||
SCOP Domains (1, 3)
Asymmetric Unit
|
CATH Domains (1, 3)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3HIP) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (HIP_MARPU | P59860)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|