Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PUTATIVE ENOYL-COA HYDRATASE FROM RHODOPSEUDOMONAS PALUSTRIS CGA009
 
Authors :  V. N. Malashkevich, R. Toro, C. Morano, J. M. Sauder, S. K. Burley, S. C. A York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  20 May 09  (Deposition) - 02 Jun 09  (Release) - 24 Oct 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (3x)
Biol. Unit 3:  A  (3x)
Biol. Unit 4:  B  (3x)
Keywords :  Structural Genomics, Crystal Structure, Protein Structure Initiative, New York Structural Genomix Research Consortium, Nysgxrc, Enoyl-Coa Hydratase, Rhodopseudomonas Palustris, Lyase, Psi-2, New York Sgx Research Center For Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. N. Malashkevich, R. Toro, C. Morano, J. M. Sauder, S. K. Burley, S. C. Almo
Crystal Structure Of Putative Enoyl-Coa Hydratase From Rhodopseudomonas Palustris Cga009
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE
    Chains: A, B
    EC Number: 4.2.1.55
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: BC-PSGX3(BC)
    Expression System Strain: BL21(DE3)CODON+RIL
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: RPA1786
    Organism Scientific: RHODOPSEUDOMONAS PALUSTRIS
    Organism Taxid: 1076
    Strain: CGA009

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): AB
Biological Unit 2 (3x): AB
Biological Unit 3 (3x): A 
Biological Unit 4 (3x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3HIN)

(-) Sites  (0, 0)

(no "Site" information available for 3HIN)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3HIN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3HIN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HIN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3HIN)

(-) Exons   (0, 0)

(no "Exon" information available for 3HIN)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:258
 aligned with Q6N8W7_RHOPA | Q6N8W7 from UniProtKB/TrEMBL  Length:268

    Alignment length:258
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257        
         Q6N8W7_RHOPA     8 AATIADPSTLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIPDQIRAVVIHGIGDHFSAGLDLSELRERDATEGLVHSQTWHRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEGSRGIFVGGGGSVRLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYDKALELGNRVAQNAPLTNFAVLQALPMIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLDHKTAKV 265
               SCOP domains d3hina_ A: automated matches                                                                                                                                                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhh.eeeeee..eeeeee.hhhhh...hhhhhhhhhhhh........eeeeee.........hhhhh...hhhhhhhhhhhhhhhhhhhhh....eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..eehhhhhhhh...eee...hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hin A   9 AATIADPSTLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIPDQIRAVVIHGIGDHFSAGLDLSELRERDATEGLVHSQTWHRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEGSRGIFVGGGGSVRLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYDKALELGNRVAQNAPLTNFAVLQALPMIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLDHKTAKV 266
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258        


Chain B from PDB  Type:PROTEIN  Length:251
 aligned with Q6N8W7_RHOPA | Q6N8W7 from UniProtKB/TrEMBL  Length:268

    Alignment length:251
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259 
         Q6N8W7_RHOPA    10 TIADPSTLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIPDQIRAVVIHGIGDHFSAGLDLSELRERDATEGLVHSQTWHRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEGSRGIFVGGGGSVRLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYDKALELGNRVAQNAPLTNFAVLQALPMIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLDH 260
               SCOP domains d3hinb_ B: automated matches                                                                                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhh.eeeeee..eeeeee.hhhhh...hhhhhhhhhhhh........eeeeee.................hhhhhhhhhhhhhhhhhhhhh....eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..eehhhhhhhh...eee...hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hin B  11 TIADPSTLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIPDQIRAVVIHGIGDHFSAGLDLSELRERDATEGLVHSQTWHRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEGSRGIFVGGGGSVRLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYDKALELGNRVAQNAPLTNFAVLQALPMIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLDH 261
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3HIN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HIN)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q6N8W7_RHOPA | Q6N8W7)
molecular function
    GO:0003859    3-hydroxybutyryl-CoA dehydratase activity    Catalysis of the reaction: (R)-3-hydroxybutanoyl-CoA = crotonoyl-CoA + H(2)O.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3hin)
 
  Sites
(no "Sites" information available for 3hin)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hin)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hin
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6N8W7_RHOPA | Q6N8W7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.55
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6N8W7_RHOPA | Q6N8W7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3HIN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3HIN)