|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3H92) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3H92) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3H92) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3H92) |
Exons (0, 0)| (no "Exon" information available for 3H92) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:86 aligned with Y3515_METJA | Q60277 from UniProtKB/Swiss-Prot Length:365 Alignment length:86 289 299 309 319 329 339 349 359 Y3515_METJA 280 ETKLEEERNHLEELLEKVEEDYEGINYDEVLEALKLFKDNYELPKSKIKRKIRIFLIKENILFLNPQKGTLKPQSYLVWNAIKRML 365 SCOP domains -------------------------------------------------------------------------------------- SCOP domains CATH domains 3h92A00 A:7-92 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 3h92 A 7 ETKLEEERNHLEELLEKVEEDYEGINYDEVLEALKLFKDNYELPKSKIKRKIRIFLIKENILFLNPQKGTLKPQSYLVWNAIKRmL 92 16 26 36 46 56 66 76 86 | 91-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3H92) |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3H92) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Y3515_METJA | Q60277)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|