|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3GXQ) |
(no "Site" information available for 3GXQ) |
(no "SS Bond" information available for 3GXQ) |
(no "Cis Peptide Bond" information available for 3GXQ) |
(no "SAP(SNP)/Variant" information available for 3GXQ) |
(no "PROSITE Motif" information available for 3GXQ) |
(no "Exon" information available for 3GXQ) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:53 aligned with A0A0H2XIU6_S | A0A0H2XIU6 from UniProtKB/TrEMBL Length:62 Alignment length:53 16 26 36 46 56 A0A0H2XIU6_S 7 NSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLEQIK 59 SCOP domains ----------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------- PROSITE Transcript ----------------------------------------------------- Transcript 3gxq A 7 NSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLEQIA 59 16 26 36 46 56 Chain B from PDB Type:PROTEIN Length:54 aligned with A0A0H2XIU6_S | A0A0H2XIU6 from UniProtKB/TrEMBL Length:62 Alignment length:54 15 25 35 45 55 A0A0H2XIU6_S 6 ENSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLEQIK 59 SCOP domains ------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------ PROSITE Transcript ------------------------------------------------------ Transcript 3gxq B 6 ENSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLEQIA 59 15 25 35 45 55 Chain C from PDB Type:DNA Length:10 3gxq C 2 ACATGACATG 11 11 Chain D from PDB Type:DNA Length:11 3gxq D 2 ACATGTCATGT 12 11
|
(no "SCOP Domain" information available for 3GXQ) |
(no "CATH Domain" information available for 3GXQ) |
(no "Pfam Domain" information available for 3GXQ) |
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3GXQ)
|
|
|
|
|
|
|