3GTU - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   LIGAND-FREE HETERODIMERIC HUMAN GLUTATHIONE S-TRANSFERASE M2-3 (EC 2.5.1.18), MONOCLINIC CRYSTAL FORM

Authors :   Y. V. Patskovsky, L. N. Patskovska, I. Listowsky

Date :   29 Jul 98 (Deposition) - 29 Jul 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: A (1x),B (1x),C (1x),D (1x)

Keywords :   Transferase, Glutathione, Conjugation, Detoxification, Cytosolic, Heterodimer (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. V. Patskovsky, L. N. Patskovska, I. Listowsky
An Asparagine-Phenylalanine Substitution Accounts For Catalytic Differences Between Hgstm3-3 And Other Human Class Mu Glutathione S-Transferases.
Biochemistry V. 38 16187 1999
PubMed-ID: 10587441 | Reference-DOI: 10.1021/BI991714T
(for further references see the PDB file header)

Molecule 1 - GLUTATHIONE S-TRANSFERASE
	Cellular Location	:	CYTOPLASM
	Cell Line	:	HELA
	Chains	:	A, C
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Gene	:	GSTM2, GSTM3
	Expression System Plasmid	:	PET3A-GSTM2-3
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector	:	PET3A
	Gene	:	GSTM2, GSTM3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	LIGAND-FREE, HETERODIMER
	Other Details - Source	:	THE GSTM2 AND GSTM3 CDNA WERE AMPLIFIED USING RT-PCR AND SUBCLONED INTO A PET3A COEXPRESSION VECTOR. SYNTHETIC GENE.

Molecule 2 - GLUTATHIONE S-TRANSFERASE
	Cellular Location	:	CYTOPLASM
	Cell Line	:	HELA
	Chains	:	B, D
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Gene	:	GSTM2, GSTM3
	Expression System Plasmid	:	PET3A-GSTM2-3
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector	:	PET3A
	Gene	:	GSTM2, GSTM3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	LIGAND-FREE, HETERODIMER
	Other Details - Source	:	THE GSTM2 AND GSTM3 CDNA WERE AMPLIFIED USING RT-PCR AND SUBCLONED INTO A PET3A COEXPRESSION VECTOR. SYNTHETIC GENE.

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:	A (1x)	B (1x)	C (1x)	D (1x)

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3GTU)

(no "Site" information available for 3GTU)

(no "SS Bond" information available for 3GTU)

Asymmetric Unit

No.	Residues
1	Leu A:59	-	Pro A:60
2	Arg A:205	-	Pro A:206
3	Leu B:63	-	Pro B:64
4	Leu C:59	-	Pro C:60
5	Arg C:205	-	Pro C:206
6	Leu D:63	-	Pro D:64

Asymmetric Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049486	S	173	N	GSTM2_HUMAN	Polymorphism	2229050	A/C	S	172	N
2	UniProt	VAR_014498	V	224	I	GSTM3_HUMAN	Polymorphism	7483	B/D	V	223	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049486	S	173	N	GSTM2_HUMAN	Polymorphism	2229050	A	S	172	N
2	UniProt	VAR_014498	V	224	I	GSTM3_HUMAN	Polymorphism	7483	B	V	223	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049486	S	173	N	GSTM2_HUMAN	Polymorphism	2229050	C	S	172	N
2	UniProt	VAR_014498	V	224	I	GSTM3_HUMAN	Polymorphism	7483	D	V	223	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049486	S	173	N	GSTM2_HUMAN	Polymorphism	2229050	A/C	S	172	N
2	UniProt	VAR_014498	V	224	I	GSTM3_HUMAN	Polymorphism	7483	B/D	V	223	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GSTM3_HUMAN	5-92	2	B:4-91 D:4-91
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTM2_HUMAN	90-208	2	A:89-207 C:89-207
2	GST_CTER	PS50405		GSTM3_HUMAN	94-212	2	B:93-211 D:93-211

Biological Unit 1 (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GSTM3_HUMAN	5-92	1	B:4-91 -
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTM2_HUMAN	90-208	1	A:89-207 -
2	GST_CTER	PS50405		GSTM3_HUMAN	94-212	1	B:93-211 -

Biological Unit 2 (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GSTM3_HUMAN	5-92	1	- D:4-91
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTM2_HUMAN	90-208	1	- C:89-207
2	GST_CTER	PS50405		GSTM3_HUMAN	94-212	1	- D:93-211

Biological Unit 3 (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GST_NTER	PS50404	Soluble glutathione S-transferase N-terminal domain profile.	GSTM3_HUMAN	5-92	2	B:4-91 D:4-91
2	GST_CTER	PS50405	Soluble glutathione S-transferase C-terminal domain profile.	GSTM2_HUMAN	90-208	2	A:89-207 C:89-207
2	GST_CTER	PS50405		GSTM3_HUMAN	94-212	2	B:93-211 D:93-211

Asymmetric Unit (16, 32)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1j	ENST00000241337	1j	ENSE00001898781	chr1:110210724-110210773	50	GSTM2_HUMAN	1-12	12	2	A:1-11 C:1-11	11 11
1.2b	ENST00000241337	2b	ENSE00001732758	chr1:110211047-110211122	76	GSTM2_HUMAN	13-38	26	2	A:12-37 C:12-37	26 26
1.2d	ENST00000241337	2d	ENSE00001662058	chr1:110211547-110211611	65	GSTM2_HUMAN	38-59	22	2	A:37-58 C:37-58	22 22
1.3b	ENST00000241337	3b	ENSE00001605407	chr1:110211912-110211993	82	GSTM2_HUMAN	60-87	28	2	A:59-86 C:59-86	28 28
1.4a	ENST00000241337	4a	ENSE00001630516	chr1:110212093-110212193	101	GSTM2_HUMAN	87-120	34	2	A:86-119 C:86-119	34 34
1.6b	ENST00000241337	6b	ENSE00001681310	chr1:110213909-110214004	96	GSTM2_HUMAN	121-152	32	2	A:120-151 C:120-151	32 32
1.7b	ENST00000241337	7b	ENSE00001746057	chr1:110214095-110214205	111	GSTM2_HUMAN	153-189	37	2	A:152-188 C:152-188	37 37
1.9e	ENST00000241337	9e	ENSE00001826241	chr1:110217369-110217908	540	GSTM2_HUMAN	190-218	29	2	A:189-217 C:189-217	29 29

2.1	ENST00000361066	1	ENSE00001192281	chr1:110283660-110283575	86	GSTM3_HUMAN	-	0	0	-	-
2.2b	ENST00000361066	2b	ENSE00001192318	chr1:110283133-110282862	272	GSTM3_HUMAN	1-16	16	2	B:1-15 D:1-15	15 15
2.2e	ENST00000361066	2e	ENSE00000913154	chr1:110282530-110282455	76	GSTM3_HUMAN	17-42	26	2	B:16-41 D:16-41	26 26
2.3	ENST00000361066	3	ENSE00001652770	chr1:110282115-110282051	65	GSTM3_HUMAN	42-63	22	2	B:41-62 D:41-62	22 22
2.4	ENST00000361066	4	ENSE00000913156	chr1:110280988-110280907	82	GSTM3_HUMAN	64-91	28	2	B:63-90 D:63-90	28 28
2.5a	ENST00000361066	5a	ENSE00000913157	chr1:110280813-110280713	101	GSTM3_HUMAN	91-124	34	2	B:90-123 D:90-123	34 34
2.6	ENST00000361066	6	ENSE00000913158	chr1:110280373-110280278	96	GSTM3_HUMAN	125-156	32	2	B:124-155 D:124-155	32 32
2.7a	ENST00000361066	7a	ENSE00000913159	chr1:110280189-110280079	111	GSTM3_HUMAN	157-193	37	2	B:156-192 D:156-192	37 37
2.7e	ENST00000361066	7e	ENSE00001417282	chr1:110279791-110279124	668	GSTM3_HUMAN	194-225	32	2	B:193-224 D:193-224	32 32

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:217
 aligned with GSTM2_HUMAN | P28161 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM2_HUMAN     2 PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK 218
               SCOP domains d3gtua2 A:1-84 Class mu GST                                                         d3gtua1 A:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 3gtuA01 A:1-85,A:191-217 Glutaredoxin                                                3gtuA02 A:86-190  [code=1.20.1050.10, no name defined]                                                   3gtuA01 A:1-85,A:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhh....eeeeee..........hhhhhhhhh.........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh.hhhh...hhhhhhhhhhh..hhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------GST_CTER  PDB: A:89-207 UniProt: 90-208                                                                                ---------- PROSITE (2)
           Transcript 1 (1) Exon 1.1j  Exon 1.2b  PDB: A:12-37   ---------------------Exon 1.3b  PDB: A:59-86     ---------------------------------Exon 1.6b  PDB: A:120-151       Exon 1.7b  PDB: A:152-188            Exon 1.9e  PDB: A:189-217     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2d  PDB: A:37-5---------------------------Exon 1.4a  PDB: A:86-119          -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3gtu A   1 PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain B from PDB  Type:PROTEIN  Length:224
 aligned with GSTM3_HUMAN | P21266 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:224
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221    
          GSTM3_HUMAN     2 SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC 225
               SCOP domains d3gtub2 B:1-84 Class mu GST                                                         d3gtub1 B:85-224 Class mu GST                                                                                                                SCOP domains
               CATH domains ----3gtuB01 B:5-89,B:195-221 Glutaredoxin                                                3gtuB02 B:90-194  [code=1.20.1050.10, no name defined]                                                   3gtuB01 B:5-89,B:195-221   --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee...hhhhhhhhhhhh....eeeeee..........hhhhhhhhh.........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh.hhhh...hhhhhhhhhhh..hhhhhhhh.hhhhh................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I- SAPs(SNPs)
                    PROSITE ---GST_NTER  PDB: B:4-91 UniProt: 5-92                                                     -GST_CTER  PDB: B:93-211 UniProt: 94-212                                                                                ------------- PROSITE
           Transcript 2 (1) Exon 2.2b      Exon 2.2e  PDB: B:16-41   ---------------------Exon 2.4  PDB: B:63-90      ---------------------------------Exon 2.6  PDB: B:124-155        Exon 2.7a  PDB: B:156-192            Exon 2.7e  PDB: B:193-224        Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------Exon 2.3  PDB: B:41-62---------------------------Exon 2.5a  PDB: B:90-123          ----------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 3gtu B   1 SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC 224
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220

Chain C from PDB  Type:PROTEIN  Length:217
 aligned with GSTM2_HUMAN | P28161 from UniProtKB/Swiss-Prot  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
          GSTM2_HUMAN     2 PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK 218
               SCOP domains d3gtuc2 C:1-84 Class mu GST                                                         d3gtuc1 C:85-217 Class mu GST                                                                                                         SCOP domains
               CATH domains 3gtuC01 C:1-85,C:191-217 Glutaredoxin                                                3gtuC02 C:86-190  [code=1.20.1050.10, no name defined]                                                   3gtuC01 C:1-85,C:191-217    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhh....eeeeee..........hhhhhhhhh.........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh.hhhh...hhhhhhhhhhh..hhhhhhhh................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------GST_CTER  PDB: C:89-207 UniProt: 90-208                                                                                ---------- PROSITE (2)
           Transcript 1 (1) Exon 1.1j  Exon 1.2b  PDB: C:12-37   ---------------------Exon 1.3b  PDB: C:59-86     ---------------------------------Exon 1.6b  PDB: C:120-151       Exon 1.7b  PDB: C:152-188            Exon 1.9e  PDB: C:189-217     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2d  PDB: C:37-5---------------------------Exon 1.4a  PDB: C:86-119          -------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3gtu C   1 PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK 217
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Chain D from PDB  Type:PROTEIN  Length:224
 aligned with GSTM3_HUMAN | P21266 from UniProtKB/Swiss-Prot  Length:225

    Alignment length:224
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221    
          GSTM3_HUMAN     2 SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC 225
               SCOP domains d3gtud2 D:1-84 Class mu GST                                                         d3gtud1 D:85-224 Class mu GST                                                                                                                SCOP domains
               CATH domains ----3gtuD01 D:5-89,D:195-221 Glutaredoxin                                                3gtuD02 D:90-194  [code=1.20.1050.10, no name defined]                                                   3gtuD01 D:5-89,D:195-221   --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee...hhhhhhhhhhhh....eeeeee..........hhhhhhhhh.........eeee..eeee.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhh.hhhh...hhhhhhhhhhh..hhhhhhhh.hhhhh................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I- SAPs(SNPs)
                    PROSITE ---GST_NTER  PDB: D:4-91 UniProt: 5-92                                                     -GST_CTER  PDB: D:93-211 UniProt: 94-212                                                                                ------------- PROSITE
           Transcript 2 (1) Exon 2.2b      Exon 2.2e  PDB: D:16-41   ---------------------Exon 2.4  PDB: D:63-90      ---------------------------------Exon 2.6  PDB: D:124-155        Exon 2.7a  PDB: D:156-192            Exon 2.7e  PDB: D:193-224        Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------Exon 2.3  PDB: D:41-62---------------------------Exon 2.5a  PDB: D:90-123          ----------------------------------------------------------------------------------------------------- Transcript 2 (2)
                 3gtu D   1 SCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC 224
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: GST C-terminal domain-like (353)

Superfamily: GST C-terminal domain-like (353)

Family: Glutathione S-transferase (GST), C-terminal domain (263)

Protein domain: Class mu GST (33)

Human (Homo sapiens) [TaxId: 9606] (15)

1a	d3gtua1	A:85-217
1b	d3gtub1	B:85-224
1c	d3gtuc1	C:85-217
1d	d3gtud1	D:85-224

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: Glutathione S-transferase (GST), N-terminal domain (216)

Protein domain: Class mu GST (33)

Human (Homo sapiens) [TaxId: 9606] (15)

2a	d3gtua2	A:1-84
2b	d3gtub2	B:1-84
2c	d3gtuc2	C:1-84
2d	d3gtud2	D:1-84

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Human (Homo sapiens) (186)

1a	3gtuA01	A:1-85,A:191-217
1b	3gtuC01	C:1-85,C:191-217
1c	3gtuB01	B:5-89,B:195-221
1d	3gtuD01	D:5-89,D:195-221

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 (267)

Homologous Superfamily: [code=1.20.1050.10, no name defined] (249)

Human (Homo sapiens) (119)

2a	3gtuA02	A:86-190
2b	3gtuC02	C:86-190
2c	3gtuB02	B:90-194
2d	3gtuD02	D:90-194

(no "Pfam Domain" information available for 3GTU)

Asymmetric Unit(hide GO term definitions)

Chain A,C (GSTM2_HUMAN | P28161)

molecular function
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0043295	glutathione binding	Interacting selectively and non-covalently with glutathione; a tripeptide composed of the three amino acids cysteine, glutamic acid and glycine.
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0070458	cellular detoxification of nitrogen compound	Any cellular process that reduces or removes the toxicity of nitrogenous compounds which are dangerous or toxic. This includes the aerobic conversion of toxic compounds to harmless substances.
	GO:0071313	cellular response to caffeine	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a caffeine stimulus. Caffeine is an alkaloid found in numerous plant species, where it acts as a natural pesticide that paralyzes and kills certain insects feeding upon them.
	GO:1901687	glutathione derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of glutathione derivative.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0060315	negative regulation of ryanodine-sensitive calcium-release channel activity	Any process that decreases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
	GO:0018916	nitrobenzene metabolic process	The chemical reactions and pathways involving nitrobenzene (nitrobenzol), a derivative of benzene with an NO2 group attached to the ring. It is a yellow aromatic liquid used in perfumery and manufactured in large quantities in the preparation of aniline.
	GO:0060316	positive regulation of ryanodine-sensitive calcium-release channel activity	Any process that increases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
	GO:0010881	regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	Any process that modulates the frequency, rate or extent of cardiac muscle contraction via the regulation of the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol. The sarcoplasmic reticulum is the endoplasmic reticulum of striated muscle, specialised for the sequestration of calcium ions that are released upon receipt of a signal relayed by the T tubules from the neuromuscular junction.
	GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	Any process that modulates the rate, frequency or extent of release of sequestered calcium ion into cytosol by the sarcoplasmic reticulum, the process in which the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol occurs via calcium release channels.
	GO:0014809	regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion	Any process that modulates the frequency, rate or extent of skeletal muscle contraction via the regulation of the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol. The sarcoplasmic reticulum is the endoplasmic reticulum of striated muscle, specialised for the sequestration of calcium ions that are released upon receipt of a signal relayed by the T tubules from the neuromuscular junction.
	GO:0055119	relaxation of cardiac muscle	The process in which the extent of cardiac muscle contraction is reduced.
	GO:0042178	xenobiotic catabolic process	The chemical reactions and pathways resulting in the breakdown of a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016529	sarcoplasmic reticulum	A fine reticular network of membrane-limited elements that pervades the sarcoplasm of a muscle cell; continuous over large portions of the cell and with the nuclear envelope; that part of the endoplasmic reticulum specialized for calcium release, uptake and storage.

Chain B,D (GSTM3_HUMAN | P21266)

molecular function
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0043295	glutathione binding	Interacting selectively and non-covalently with glutathione; a tripeptide composed of the three amino acids cysteine, glutamic acid and glycine.
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0070458	cellular detoxification of nitrogen compound	Any cellular process that reduces or removes the toxicity of nitrogenous compounds which are dangerous or toxic. This includes the aerobic conversion of toxic compounds to harmless substances.
	GO:0008065	establishment of blood-nerve barrier	The establishment of the barrier between the perineurium of peripheral nerves and the vascular endothelium of endoneurial capillaries. The perineurium acts as a diffusion barrier, but ion permeability at the blood-nerve barrier is still higher than at the blood-brain barrier.
	GO:1901687	glutathione derivative biosynthetic process	The chemical reactions and pathways resulting in the formation of glutathione derivative.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0018916	nitrobenzene metabolic process	The chemical reactions and pathways involving nitrobenzene (nitrobenzol), a derivative of benzene with an NO2 group attached to the ring. It is a yellow aromatic liquid used in perfumery and manufactured in large quantities in the preparation of aniline.
	GO:0043627	response to estrogen	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by an estrogen, C18 steroid hormones that can stimulate the development of female sexual characteristics.
	GO:0042178	xenobiotic catabolic process	The chemical reactions and pathways resulting in the breakdown of a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0035686	sperm fibrous sheath	A cytoskeletal structure surrounding the axoneme and outer dense fibers of the sperm flagellum. Consists of two longitudinal columns connected by closely arrayed semicircular ribs that assemble from distal to proximal throughout spermiogenesis. The fibrous sheath probably influences the degree of flexibility, plane of flagellar motion, and the shape of the flagellar beat.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3gtu)

	Sites
(no "Sites" information available for 3gtu)

	Cis Peptide Bonds
		Arg A:205 - Pro A:206	[ RasMol ]
		Arg C:205 - Pro C:206	[ RasMol ]
		Leu A:59 - Pro A:60	[ RasMol ]
		Leu B:63 - Pro B:64	[ RasMol ]
		Leu C:59 - Pro C:60	[ RasMol ]
		Leu D:63 - Pro D:64	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3gtu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GSTM2_HUMAN \| P28161
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GSTM3_HUMAN \| P21266
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GSTM2_HUMAN \| P28161
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	GSTM3_HUMAN \| P21266
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GSTM2_HUMAN \| P28161	:	1hna 1hnb 1hnc 1xw5 1ykc 2ab6 2c4j 2gtu 3gur

(no "Related Entries Specified in the PDB File" available for 3GTU)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (2, 6)

Exons (16, 32)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (29, 43)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File