|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3GCE) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3GCE) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3GCE) |
Exons (0, 0)| (no "Exon" information available for 3GCE) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:104 aligned with Q2HWH6_9ACTN | Q2HWH6 from UniProtKB/TrEMBL Length:115 Alignment length:104 18 28 38 48 58 68 78 88 98 108 Q2HWH6_9ACTN 9 STPVRVATLDQLKPGVPTAFDVDGDEVMVVRDGDSVYAISNLCSHAEAYLDMGVFHAESLEIECPLHVGRFDVRTGAPTALPCVLPVRAYDVVVDGTEILVAPK 112 SCOP domains d3gcea_ A: automated matches SCOP domains CATH domains 3gceA00 A:9-112 'Rieske'-like iron-sulphur domains CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 3gce A 9 STPVRVATLDQLKPGVPTAFDVDGDEVMVVRDGDSVYAISNLCSHAEAYLDMGVFHAESLEIECPLHVGRFDVRTGAPTALPCVLPVRAYDVVVDGTEILVAPK 112 18 28 38 48 58 68 78 88 98 108
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3GCE) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q2HWH6_9ACTN | Q2HWH6)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|