|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3FX7) |
Sites (0, 0)| (no "Site" information available for 3FX7) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3FX7) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3FX7) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3FX7) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3FX7) |
Exons (0, 0)| (no "Exon" information available for 3FX7) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:84 aligned with O24902_HELPY | O24902 from UniProtKB/TrEMBL Length:86 Alignment length:84 86 14 24 34 44 54 64 74 84 | O24902_HELPY 5 QMDTEEVREFVGHLERFKELLREEVNSLSNHFHNLESWRDARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIRVLEEDY-- - SCOP domains d3fx7a_ A: automated matches SCOP domains CATH domains 3fx7A00 A:5-88 HP0062-like CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 3fx7 A 5 QMDTEEVREFVGHLERFKELLREEVNSLSNHFHNLESWRDARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIRVLEEDYLE 88 14 24 34 44 54 64 74 84 Chain B from PDB Type:PROTEIN Length:87 aligned with O24902_HELPY | O24902 from UniProtKB/TrEMBL Length:86 Alignment length:87 86 14 24 34 44 54 64 74 84 | O24902_HELPY 5 QMDTEEVREFVGHLERFKELLREEVNSLSNHFHNLESWRDARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIRVLEEDY----- - SCOP domains d3fx7b_ B: automated matches SCOP domains CATH domains 3fx7B00 B:5-91 HP0062-like CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 3fx7 B 5 QMDTEEVREFVGHLERFKELLREEVNSLSNHFHNLESWRDARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIRVLEEDYLEHHH 91 14 24 34 44 54 64 74 84
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3FX7) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3FX7)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|