Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF LEISHMANIA MAJOR MIF2
 
Authors :  M. D. Walkinshaw, J. M. Richardson
Date :  19 Jan 09  (Deposition) - 17 Mar 09  (Release) - 17 Mar 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Homotrimer, Tautomerase, Cytokine (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. M. Richardson, L. S. Morrison, N. D. Bland, S. Bruce, G. H. Coombs, J. C. Mottram, M. D. Walkinshaw
Structures Of Leishmania Major Orthologues Of Macrophage Migration Inhibitory Factor
Biochem. Biophys. Res. Commun. V. 380 442 2009
PubMed-ID: 19187777  |  Reference-DOI: 10.1016/J.BBRC.2009.01.030
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MACROPHAGE MIGRATION INHIBITORY FACTOR-LIKE PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneLMJF33.1750
    Organism ScientificLEISHMANIA MAJOR
    Organism Taxid5664
    StrainFRIEDLIN

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (3x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3FWT)

(-) Sites  (0, 0)

(no "Site" information available for 3FWT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3FWT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3FWT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3FWT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3FWT)

(-) Exons   (0, 0)

(no "Exon" information available for 3FWT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:116
 aligned with Q4Q412_LEIMA | Q4Q412 from UniProtKB/TrEMBL  Length:113

    Alignment length:116
                               1                                                                                                                
                               |     7        17        27        37        47        57        67        77        87        97       107      
         Q4Q412_LEIMA     - ---MPFLQTIVSVSLDDQKRANLSAAYGMICREELGKPEDFVMTAFSDKTPISFQGSTAPAAYVRVESWGEYAPSKPKMMTPRIAAAITKECGIPAERIYVFYYSTKHCGWNGTNF 113
               SCOP domains d3fwta_ A: automated matches                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeee....hhhhhhhhhhhhhhhhhhhhh......eeeee..............eeeeeeeee...hhhhhhhhhhhhhhhhhhhh.hhh.eeeeeeee...ee..ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 3fwt A  -3 GSHMPFLQTIVSVSLDDQKRANLSAAYGMICREELGKPEDFVMTAFSDKTPISFQGSTAPAAYVRVESWGEYAPSKPKMMTPRIAAAITKECGIPAERIYVFYYSTKHCGWNGTNF 112
                                     6        16        26        36        46        56        66        76        86        96       106      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3FWT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3FWT)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3FWT)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3fwt)
 
  Sites
(no "Sites" information available for 3fwt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3fwt)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3fwt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q4Q412_LEIMA | Q4Q412
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q4Q412_LEIMA | Q4Q412
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3FWT)

(-) Related Entries Specified in the PDB File

3fwu