Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE FROM PORPHYROMONAS GINGIVALIS
 
Authors :  Z. Zhang, S. Eswaramoorthy, S. K. Burley, S. Swaminathan, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  16 Dec 08  (Deposition) - 03 Feb 09  (Release) - 03 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,C  (1x)
Keywords :  11247B, Structural Genomic, L-Threonine-O-3-Phosphate Decarboxylase Porphyromonas Gingivalis, , Structural Genomics, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Zhang, S. Eswaramoorthy, S. K. Burley, S. Swaminathan
The Crystal Structure Of L-Threonine-O-3-Phosphate Decarboxylase From Porphyromonas Gingivalis
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: BC-PSGX3
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: PG_0012
    Organism Common: BACTEROIDES GINGIVALIS
    Organism Scientific: PORPHYROMONAS GINGIVALIS
    Organism Taxid: 837
    Strain: ATCC BAA-308 / W83

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A  D
Biological Unit 2 (1x):  BC 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 27)

Asymmetric Unit (1, 27)
No.NameCountTypeFull Name
1MSE27Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 13)
No.NameCountTypeFull Name
1MSE13Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 14)
No.NameCountTypeFull Name
1MSE14Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3FKD)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3FKD)

(-) Cis Peptide Bonds  (13, 13)

Asymmetric Unit
No.Residues
1Ile A:96 -Pro A:97
2Asn A:137 -Pro A:138
3Asn A:140 -Pro A:141
4Ile B:96 -Pro B:97
5Asn B:137 -Pro B:138
6Asn B:140 -Pro B:141
7Gly C:28 -Asp C:29
8Ile C:96 -Pro C:97
9Asn C:137 -Pro C:138
10Asn C:140 -Pro C:141
11Ile D:96 -Pro D:97
12Asn D:137 -Pro D:138
13Asn D:140 -Pro D:141

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3FKD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3FKD)

(-) Exons   (0, 0)

(no "Exon" information available for 3FKD)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:326
 aligned with Q7MXY2_PORGI | Q7MXY2 from UniProtKB/TrEMBL  Length:342

    Alignment length:326
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335      
         Q7MXY2_PORGI    16 EIVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQMLAKRNSVDNNAILVTNGPTAAFYQIAQAFRGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNEDIGEADFSNMDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTTFVLDQSYVSFTTEEVIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFLLRLKKGTAAELKKYMLEEYNMLIRDASNFRGLDESYVRITTQRPAQNQLFIKALETFLEK 341
               SCOP domains d3fkda_ A: automated matches                                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee..........hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhh.eeeehhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhh..eeeeee...hhhhh......eeeee..........hhhhhhhhhhhh...eeeee............hhhhhh....eeeeeehhhhhhhhhhh.eeee.hhhhhhhhhh.......hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh..eee......eeeeee...hhhhhhhhhhhh..ee.ee..........eeeee..hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fkd A  16 EIVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQmLAKRNSVDNNAILVTNGPTAAFYQIAQAFRGSRSLIAIPSFAEYEDACRmYEHEVCFYPSNEDIGEADFSNmDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTTFVLDQSYVSFTTEEVIRPADIKGRKNLVmVYSFSHAYGIPGLRIGYIVANKDFmKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFLLRLKKGTAAELKKYmLEEYNmLIRDASNFRGLDESYVRITTQRPAQNQLFIKALETFLEK 341
                                    25        35        45        55  |     65        75        85        95       105  |    115       125    |  135       145       155       165       175       185     | 195       205       215|      225       235       245       255       265       275       285       295|     |305       315       325       335      
                                                                     58-MSE                                           108-MSE               130-MSE                                                      191-MSE                  216-MSE                                                                         296-MSE |                                       
                                                                                                                                                                                                                                                                                                                        302-MSE                                   


Chain B from PDB  Type:PROTEIN  Length:325
 aligned with Q7MXY2_PORGI | Q7MXY2 from UniProtKB/TrEMBL  Length:342

    Alignment length:325
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336     
         Q7MXY2_PORGI    17 IVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQMLAKRNSVDNNAILVTNGPTAAFYQIAQAFRGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNEDIGEADFSNMDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTTFVLDQSYVSFTTEEVIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFLLRLKKGTAAELKKYMLEEYNMLIRDASNFRGLDESYVRITTQRPAQNQLFIKALETFLEK 341
               SCOP domains d3fkdb_ B: automated matches                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..........hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhh.eeee.hhhhhhhhhhhhh...eeeeee..hhhhhhhhhhh..eeeeee...hhhhh......eeeee..........hhhhhhhhhhhh...eeeee..hhhhh.....hhhhhh....eeeeee......hhhhh.eeee.hhhhhhhhhh.......hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh..eee......eeeeee...hhhhhhhhhhhh..ee.ee.hhh......eeeee..hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fkd B  17 IVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQmLAKRNSVDNNAILVTNGPTAAFYQIAQAFRGSRSLIAIPSFAEYEDACRmYEHEVCFYPSNEDIGEADFSNmDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTTFVLDQSYVSFTTEEVIRPADIKGRKNLVmVYSFSHAYGIPGLRIGYIVANKDFmKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFLLRLKKGTAAELKKYmLEEYNmLIRDASNFRGLDESYVRITTQRPAQNQLFIKALETFLEK 341
                                    26        36        46        56 |      66        76        86        96       106 |     116       126   |   136       146       156       166       176       186    |  196       206       216       226       236       246       256       266       276       286       296     | 306       316       326       336     
                                                                    58-MSE                                           108-MSE               130-MSE                                                      191-MSE                  216-MSE                                                                         296-MSE |                                       
                                                                                                                                                                                                                                                                                                                       302-MSE                                   


Chain C from PDB  Type:PROTEIN  Length:325
 aligned with Q7MXY2_PORGI | Q7MXY2 from UniProtKB/TrEMBL  Length:342

    Alignment length:326
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336      
         Q7MXY2_PORGI    17 IVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQMLAKRNSVDNNAILVTNGPTAAFYQIAQAFRGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNEDIGEADFSNMDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTTFVLDQSYVSFTTEEVIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFLLRLKKGTAAELKKYMLEEYNMLIRDASNFRGLDESYVRITTQRPAQNQLFIKALETFLEKY 342
               SCOP domains d3fkdc_ C: au tomated matches                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..........-hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhh.eeeehhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhh..eeeeee...hhhhh......eeeee..........hhhhhhhhhhhh...eeeee..hhhhh.....hhhhhh....eeeeee......hhhhh.eeeeehhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..eee......eeeeee...hhhhhhhhhhhh..ee.ee..........eeeee..hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fkd C  17 IVNFSTTVWTDGD-DHLEKHLVENLNCIRHYPEPDAGTLRQmLAKRNSVDNNAILVTNGPTAAFYQIAQAFRGSRSLIAIPSFAEYEDACRmYEHEVCFYPSNEDIGEADFSNmDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTTFVLDQSYVSFTTEEVIRPADIKGRKNLVmVYSFSHAYGIPGLRIGYIVANKDFmKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFLLRLKKGTAAELKKYmLEEYNmLIRDASNFRGLDESYVRITTQRPAQNQLFIKALETFLEKY 342
                                    26  | |   36        46        56 |      66        76        86        96       106 |     116       126   |   136       146       156       166       176       186    |  196       206       216       226       236       246       256       266       276       286       296     | 306       316       326       336      
                                       29 |                         58-MSE                                           108-MSE               130-MSE                                                      191-MSE                  216-MSE                                                                         296-MSE |                                        
                                         31                                                                                                                                                                                                                                                                            302-MSE                                    


Chain D from PDB  Type:PROTEIN  Length:310
 aligned with Q7MXY2_PORGI | Q7MXY2 from UniProtKB/TrEMBL  Length:342

    Alignment length:317
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       
         Q7MXY2_PORGI    21 STTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQMLAKRNSVDNNAILVTNGPTAAFYQIAQAFRGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNEDIGEADFSNMDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTTFVLDQSYVSFTTEEVIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFLLRLKKGTAAELKKYMLEEYNMLIRDASNFRGLDESYVRITTQRPAQNQLFIKALET 337
               SCOP domains d3fkdd_  D: automated matches                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........-hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhh.eeeehhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhh..eeeeee...hhhhh......eeeee..........hhhhhhhhhhhh...eeeee............hhhhhh....eeeeee......hhhhh.eeeeehhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh...ee.......eeeeee...hhhhhhh------....ee.hhh......eeeee..hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fkd D  21 STTVWTDG-KDHLEKHLVENLNCIRHYPEPDAGTLRQmLAKRNSVDNNAILVTNGPTAAFYQIAQAFRGSRSLIAIPSFAEYEDACRmYEHEVCFYPSNEDIGEADFSNmDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTTFVLDQSYVSFTTEEVIRPADIKGRKNLVmVYSFSHAYGIPGLRIGYIVANKDFmKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFLLRLKKGTAAELKK------NmLIRDASNFRGLDESYVRITTQRPAQNQLFIKALET 337
                                   |30        40        50       |60        70        80        90       100       110       120       130       140       150       160       170       180       190|      200       210     | 220       230       240       250       260       270       280       290   |     -||     310       320       330       
                                  28 |                          58-MSE                                           108-MSE               130-MSE                                                      191-MSE                  216-MSE                                                                       294    301|                                   
                                    30                                                                                                                                                                                                                                                                             302-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3FKD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3FKD)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q7MXY2_PORGI | Q7MXY2)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0030170    pyridoxal phosphate binding    Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
biological process
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3fkd)
 
  Cis Peptide Bonds
    Asn A:137 - Pro A:138   [ RasMol ]  
    Asn A:140 - Pro A:141   [ RasMol ]  
    Asn B:137 - Pro B:138   [ RasMol ]  
    Asn B:140 - Pro B:141   [ RasMol ]  
    Asn C:137 - Pro C:138   [ RasMol ]  
    Asn C:140 - Pro C:141   [ RasMol ]  
    Asn D:137 - Pro D:138   [ RasMol ]  
    Asn D:140 - Pro D:141   [ RasMol ]  
    Gly C:28 - Asp C:29   [ RasMol ]  
    Ile A:96 - Pro A:97   [ RasMol ]  
    Ile B:96 - Pro B:97   [ RasMol ]  
    Ile C:96 - Pro C:97   [ RasMol ]  
    Ile D:96 - Pro D:97   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3fkd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7MXY2_PORGI | Q7MXY2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q7MXY2_PORGI | Q7MXY2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3FKD)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3FKD)