|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3FCG) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3FCG) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3FCG) |
PROSITE Motifs (1, 2)
Asymmetric/Biological Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3FCG) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:75 aligned with CAF1A_YERPE | P26949 from UniProtKB/Swiss-Prot Length:833 Alignment length:78 269 279 289 299 309 319 329 CAF1A_YERPE 260 PYYQWNFAPVVRGIARTQARVEVLRDGYTVSNELVPSGPFELANLPLGGGSGELKVIIHESDGTKQVFTVPYDTPAVA 337 SCOP domains ------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ----------------------------------FIMBRIAL_US--------------------------------- PROSITE Transcript ------------------------------------------------------------------------------ Transcript 3fcg A 239 PYYQWNFAPVVRGIARTQARVEVLRDGYTVSNELVPSGPFELANLP---GSGELKVIIHESDGTKQVFTVPYDTPAVA 316 248 258 268 278 | 288 298 308 284 288 Chain B from PDB Type:PROTEIN Length:71 aligned with CAF1A_YERPE | P26949 from UniProtKB/Swiss-Prot Length:833 Alignment length:77 269 279 289 299 309 319 329 CAF1A_YERPE 260 PYYQWNFAPVVRGIARTQARVEVLRDGYTVSNELVPSGPFELANLPLGGGSGELKVIIHESDGTKQVFTVPYDTPAV 336 SCOP domains ----------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------FIMBRIAL_US-------------------------------- PROSITE Transcript ----------------------------------------------------------------------------- Transcript 3fcg B 239 PYYQWNFAPVVRGIARTQARVEVLRDGYTVSNELVPSGPFELANLP------ELKVIIHESDGTKQVFTVPYDTPAV 315 248 258 268 278 | - | 298 308 284 291
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3FCG) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3FCG) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3FCG) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CAF1A_YERPE | P26949)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|