Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A PUTATIVE GLYOXALASE FROM AN ENVIRONMENTAL BACTERIA
 
Authors :  M. Silberstein, S. Eswaramoorthy, S. K. Burley, S. Swaminathan, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  21 Nov 08  (Deposition) - 09 Dec 08  (Release) - 09 Dec 08  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.92
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Lactoylglutathione Lyase, Yecm, 11004A, Psi2, Nysgxrc, Structural Genomics, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Silberstein, S. Eswaramoorthy, S. K. Burley, S. Swaminathan
Crystal Structure Of A Putative Glyoxalase From An Environmental Bacteria
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - LYASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: BC-PSGX3(BC)
    Expression System Strain: BL21 (DE3) CODON+RIL
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: UNCULTURED BACTERIUM
    Organism Taxid: 77133
    Synonym: ORF125EGC139

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3FCD)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3FCD)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3FCD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3FCD)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3FCD)

(-) Exons   (0, 0)

(no "Exon" information available for 3FCD)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:117
 aligned with Q93AH5_9BACT | Q93AH5 from UniProtKB/TrEMBL  Length:124

    Alignment length:126
                                                                                                                                                  124     
                                    13        23        33        43        53        63        73        83        93       103       113       123|     
         Q93AH5_9BACT     4 IHQITPFLHIPDMQEALTLFCDTLGFELKYRHSNYAYLELSGCGLRLLEEPARKIIPDGIARVAICIDVSDIDSLHTKLSPALENLPADQVEPLKNMPYGQREFQVRMPDGDWLNFTAPLA-----   -
               SCOP domains d3fcda_ A: automated matches                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeeee.hhhhhhhhhh.....eeeeee..eeeeee..eeeeeee..---------..eeeeee..hhhhhhhhhhhhhhhhhhh.eeeeee....eeeeeee.....eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3fcd A   4 IHQITPFLHIPDmQEALTLFCDTLGFELKYRHSNYAYLELSGCGLRLLEEP---------ARVAICIDVSDIDSLHTKLSPALENLPADQVEPLKNmPYGQREFQVRmPDGDWLNFTAPLAEGHHH 129
                                    13  |     23        33        43        53|        -|       73        83        93      |103       113       123      
                                       16-MSE                                54        64                                 100-MSE    111-MSE              


Chain B from PDB  Type:PROTEIN  Length:119
 aligned with Q93AH5_9BACT | Q93AH5 from UniProtKB/TrEMBL  Length:124

    Alignment length:128
                                                                                                                                                  124       
                                    13        23        33        43        53        63        73        83        93       103       113       123|       
         Q93AH5_9BACT     4 IHQITPFLHIPDMQEALTLFCDTLGFELKYRHSNYAYLELSGCGLRLLEEPARKIIPDGIARVAICIDVSDIDSLHTKLSPALENLPADQVEPLKNMPYGQREFQVRMPDGDWLNFTAPLA-------   -
               SCOP domains d3fcdb_ B: automated matches                                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee.hhhhhhhhhh.....eeeeee..eeeeee..eeeeeee..---------..eeeeee..hhhhhhhhhhhhhhhhhhhhh...ee....eeeeeee.....eeeeeee......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fcd B   4 IHQITPFLHIPDmQEALTLFCDTLGFELKYRHSNYAYLELSGCGLRLLEEP---------ARVAICIDVSDIDSLHTKLSPALENLPADQVEPLKNmPYGQREFQVRmPDGDWLNFTAPLAEGHHHHH 131
                                    13  |     23        33        43        53|        -|       73        83        93      |103       113       123        
                                       16-MSE                                54        64                                 100-MSE    111-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3FCD)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3FCD)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3FCD)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3fcd)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3fcd)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3fcd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q93AH5_9BACT | Q93AH5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q93AH5_9BACT | Q93AH5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3FCD)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3FCD)