Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF THE ACETYLTRANSFERASE (GNAT FAMILY) FROM BACILLUS ANTHRACIS
 
Authors :  R. Zhang, X. Xu, H. Cui, A. Savchenko, A. Edwards, A. Joachimiak, Midwes For Structural Genomics (Mcsg)
Date :  19 Nov 08  (Deposition) - 23 Dec 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A (1x),B (1x)
Biol. Unit 2:  A,B  (1x)
Keywords :  Acetyltransferase (Gnat Family), Bacillus Anthracis, Structural Genomics, Psi2, Mcsg, Protein Structure Initiative, Midwest Center For Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Zhang, X. Xu, H. Cui, A. Savchenko, A. Edwards, A. Joachimiak
The Crystal Structure Of The Acetyltransferase (Gnat Family From Bacillus Anthracis
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ACETYLTRANSFERASE, GNAT FAMILY
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG7
    Expression System StrainBL21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism CommonANTHRAX,ANTHRAX BACTERIUM
    Organism ScientificBACILLUS ANTHRACIS STR. STERNE
    Organism Taxid260799
    StrainSTR. STERNE]

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A (1x)B (1x)
Biological Unit 2 (1x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1COA1Ligand/IonCOENZYME A
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1COA1Ligand/IonCOENZYME A
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1COA1Ligand/IonCOENZYME A

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:30 , TRP A:88 , PHE A:90 , PHE A:95 , ASN A:96 , LYS A:97 , GLY A:98 , TYR A:99 , ALA A:100 , SER A:101 , THR A:123 , CYS A:124 , ASN A:128 , THR A:129 , PRO A:130 , SER A:131 , ARG A:133 , LYS A:137 , HOH A:176 , HOH A:195 , HOH A:281 , HOH A:287 , HOH A:297 , HOH A:347 , PHE B:2BINDING SITE FOR RESIDUE COA A 169

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3FBU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3FBU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3FBU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3FBU)

(-) Exons   (0, 0)

(no "Exon" information available for 3FBU)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:166
 aligned with Q81Q99_BACAN | Q81Q99 from UniProtKB/TrEMBL  Length:168

    Alignment length:168
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160        
         Q81Q99_BACAN     1 MFIKAERLLIRKFEFKDWEAVHEYTSDSDVMKYIPEGVFTEEDTRNFVNKNMGENAKNFPVILIGENILVGHIVFHKYFGEHTYEIGWVFNPKYFNKGYASEAAQATLKYGFKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNEWWDEYYYAILEEE 168
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3fbuA00 A:1-168  [code=3.40.630.30, no name defined]                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee...eee...hhhhhhhhhhhhh.............hhhhhhhhhhhh..--..eeeeee....eeeeeeeeeeee...eeeeeeee.hhhh..hhhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3fbu A   1 MFIKAERLLIRKFEFKDWEAVHEYTSDSDVMKYIPEGVFTEEDTRNFVNKNMG--AKNFPVILIGENILVGHIVFHKYFGEHTYEIGWVFNPKYFNKGYASEAAQATLKYGFKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNEWWDEYYYAILEEE 168
                                    10        20        30        40        50  |  |  60        70        80        90       100       110       120       130       140       150       160        
                                                                               53 56                                                                                                                

Chain B from PDB  Type:PROTEIN  Length:166
 aligned with Q81Q99_BACAN | Q81Q99 from UniProtKB/TrEMBL  Length:168

    Alignment length:168
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160        
         Q81Q99_BACAN     1 MFIKAERLLIRKFEFKDWEAVHEYTSDSDVMKYIPEGVFTEEDTRNFVNKNMGENAKNFPVILIGENILVGHIVFHKYFGEHTYEIGWVFNPKYFNKGYASEAAQATLKYGFKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNEWWDEYYYAILEEE 168
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3fbuB00 B:1-168  [code=3.40.630.30, no name defined]                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee...eee...hhhhhhhhhhhhh.............hhhhhhhhhhhh.--...eeeeee....eeeeeeeeeeee...eeeeeeee.hhhhhhhhhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3fbu B   1 MFIKAERLLIRKFEFKDWEAVHEYTSDSDVMKYIPEGVFTEEDTRNFVNKNM--NAKNFPVILIGENILVGHIVFHKYFGEHTYEIGWVFNPKYFNKGYASEAAQATLKYGFKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNEWWDEYYYAILEEE 168
                                    10        20        30        40        50 |  |   60        70        80        90       100       110       120       130       140       150       160        
                                                                              52 55                                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3FBU)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3FBU)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q81Q99_BACAN | Q81Q99)
molecular function
    GO:0008080    N-acetyltransferase activity    Catalysis of the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    COA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3fbu)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3fbu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81Q99_BACAN | Q81Q99
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q81Q99_BACAN | Q81Q99
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3FBU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3FBU)