|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3F6V) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3F6V) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3F6V) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3F6V) |
Exons (0, 0)| (no "Exon" information available for 3F6V) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:96 aligned with Q0S966_RHOJR | Q0S966 from UniProtKB/TrEMBL Length:129 Alignment length:96 35 45 55 65 75 85 95 105 115 Q0S966_RHOJR 26 VLDQLEVAAEPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDGRFRYYRLDPQGLAQLRALFDSFWIDELDRLVADATE 121 SCOP domains ------------------------------------------------------------------------------------------------ SCOP domains CATH domains 3f6vA00 A:26-121 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 3f6v A 26 VLDQLEVAAEPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDGRFRYYRLDPQGLAQLRALFDSFWIDELDRLVADATE 121 35 45 55 65 75 85 95 105 115
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3F6V) |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3F6V) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (Q0S966_RHOJR | Q0S966)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|