3F1I - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   HUMAN ESCRT-0 CORE COMPLEX

Authors :   X. Ren, D. P. Kloer, Y. Kim, R. Ghirlando, L. Saidi, G. Hummer, J. H. Hurle

Date :   28 Oct 08 (Deposition) - 24 Mar 09 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : C,H,S

Keywords :   Hgs, Stam, Escrt, Ubiquitin, Mvb, Endosome, Membrane, Metal-Binding, Phosphoprotein, Protein Transport, Transport, Zinc-Finger, Sh3 Domain, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. Ren, D. P. Kloer, Y. C. Kim, R. Ghirlando, L. F. Saidi, G. Hummer, J. H. Hurley
Hybrid Structural Model Of The Complete Human Escrt-0 Complex.
Structure V. 17 406 2009
PubMed-ID: 19278655 | Reference-DOI: 10.1016/J.STR.2009.01.012

Molecule 1 - HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASE SUBSTRATE
	Chains	:	H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PST39
	Expression System Strain	:	ROSETTA 2 (DE3) PLYS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASIMD
	Fragment	:	HELICAL DOMAIN
	Gene	:	HEPATOCYTE GROWTH FACTOR REGULATED TYROSINE KINASE SUBSTRATE (HGS), HGS, HRS
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PROTEIN PP110, HRS

Molecule 2 - SIGNAL TRANSDUCING ADAPTER MOLECULE 1
	Chains	:	S, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PST39
	Expression System Strain	:	ROSETTA 2 (DE3) PLYS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	HELICAL DOMAIN
	Gene	:	SIGNAL TRANSDUCING ADAPTOR MOLECULE (STAM), STAM, STAM1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	STAM-1

		1	2	3
Asymmetric/Biological Unit	:	C	H	S

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3F1I)

(no "Site" information available for 3F1I)

(no "SS Bond" information available for 3F1I)

(no "Cis Peptide Bond" information available for 3F1I)

(no "SAP(SNP)/Variant" information available for 3F1I)

(no "PROSITE Motif" information available for 3F1I)

Asymmetric/Biological Unit (2, 2)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000329138	1a	ENSE00001391303	chr17:79651020-79651133	114	HGS_HUMAN	1-13	13	0	-	-
1.2	ENST00000329138	2	ENSE00001308807	chr17:79652635-79652719	85	HGS_HUMAN	13-41	29	0	-	-
1.3	ENST00000329138	3	ENSE00001325636	chr17:79653342-79653417	76	HGS_HUMAN	41-66	26	0	-	-
1.4	ENST00000329138	4	ENSE00001314149	chr17:79654033-79654125	93	HGS_HUMAN	67-97	31	0	-	-
1.5	ENST00000329138	5	ENSE00001296740	chr17:79655734-79655857	124	HGS_HUMAN	98-139	42	0	-	-
1.6	ENST00000329138	6	ENSE00001316542	chr17:79657212-79657264	53	HGS_HUMAN	139-156	18	0	-	-
1.7	ENST00000329138	7	ENSE00001292653	chr17:79657704-79657772	69	HGS_HUMAN	157-179	23	0	-	-
1.8	ENST00000329138	8	ENSE00001306492	chr17:79658477-79658601	125	HGS_HUMAN	180-221	42	0	-	-
1.9	ENST00000329138	9	ENSE00001296588	chr17:79660533-79660611	79	HGS_HUMAN	221-247	27	0	-	-
1.10	ENST00000329138	10	ENSE00001313160	chr17:79660684-79660782	99	HGS_HUMAN	248-280	33	0	-	-
1.11	ENST00000329138	11	ENSE00001292556	chr17:79660900-79660995	96	HGS_HUMAN	281-312	32	0	-	-
1.12	ENST00000329138	12	ENSE00001314367	chr17:79661845-79661883	39	HGS_HUMAN	313-325	13	0	-	-
1.13	ENST00000329138	13	ENSE00001303643	chr17:79661954-79662097	144	HGS_HUMAN	326-373	48	0	-	-
1.14	ENST00000329138	14	ENSE00001321161	chr17:79662194-79662253	60	HGS_HUMAN	374-393	20	0	-	-
1.15	ENST00000329138	15	ENSE00001299855	chr17:79662816-79663029	214	HGS_HUMAN	394-465	72	1	H:404-465	62
1.16b	ENST00000329138	16b	ENSE00001299623	chr17:79663387-79663559	173	HGS_HUMAN	465-522	58	1	H:465-501	37
1.17	ENST00000329138	17	ENSE00001301435	chr17:79663637-79663777	141	HGS_HUMAN	523-569	47	0	-	-
1.18a	ENST00000329138	18a	ENSE00001421749	chr17:79663854-79664028	175	HGS_HUMAN	570-628	59	0	-	-
1.19	ENST00000329138	19	ENSE00001300174	chr17:79667497-79667630	134	HGS_HUMAN	628-672	45	0	-	-
1.20	ENST00000329138	20	ENSE00001320441	chr17:79667725-79667844	120	HGS_HUMAN	673-712	40	0	-	-
1.21	ENST00000329138	21	ENSE00001296545	chr17:79668075-79668161	87	HGS_HUMAN	713-741	29	0	-	-
1.22a	ENST00000329138	22a	ENSE00001319441	chr17:79668538-79669143	606	HGS_HUMAN	742-777	36	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain C from PDB  Type:PROTEIN  Length:24
 aligned with STAM1_HUMAN | Q92783 from UniProtKB/Swiss-Prot  Length:540

    Alignment length:24
                                   347       357    
          STAM1_HUMAN   338 QMGPLIDEKLEDIDRKHSELSELN 361
               SCOP domains ------------------------ SCOP domains
               CATH domains ------------------------ CATH domains
               Pfam domains ------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------ SAPs(SNPs)
                    PROSITE ------------------------ PROSITE
                 Transcript ------------------------ Transcript
                 3f1i C 338 QMGPLIDEKLEDIDRKHSELSELN 361
                                   347       357

Chain H from PDB  Type:PROTEIN  Length:98
 aligned with HGS_HUMAN | O14964 from UniProtKB/Swiss-Prot  Length:777

    Alignment length:98
                                   413       423       433       443       453       463       473       483       493        
            HGS_HUMAN   404 SHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEE 501
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.15  PDB: H:404-465 UniProt: 394-465 [INCOMPLETE]       ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.16b  PDB: H:465-501            Transcript 1 (2)
                 3f1i H 404 SHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEE 501
                                   413       423       433       443       453       463       473       483       493

Chain S from PDB  Type:PROTEIN  Length:77
 aligned with STAM1_HUMAN | Q92783 from UniProtKB/Swiss-Prot  Length:540

    Alignment length:77
                                   310       320       330       340       350       360       370       
          STAM1_HUMAN   301 FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE 377
               SCOP domains ----------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                 3f1i S 301 FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE 377
                                   310       320       330       340       350       360       370

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3F1I)

(no "CATH Domain" information available for 3F1I)

(no "Pfam Domain" information available for 3F1I)

Asymmetric/Biological Unit(hide GO term definitions)

Chain C,S (STAM1_HUMAN | Q92783)

molecular function
	GO:0005070	SH3/SH2 adaptor activity	Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006914	autophagy	The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
	GO:0016197	endosomal transport	The directed movement of substances into, out of, or mediated by an endosome, a membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to lysosomes for degradation.
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0036258	multivesicular body assembly	The aggregation, arrangement and bonding together of a set of components to form a multivesicular body, a type of late endosome in which regions of the limiting endosomal membrane invaginate to form internal vesicles; membrane proteins that enter the internal vesicles are sequestered from the cytoplasm.
	GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
	GO:1903543	positive regulation of exosomal secretion	Any process that activates or increases the frequency, rate or extent of exosomal secretion.
	GO:0009967	positive regulation of signal transduction	Any process that activates or increases the frequency, rate or extent of signal transduction.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:1903551	regulation of extracellular exosome assembly	Any process that modulates the frequency, rate or extent of extracellular vesicular exosome assembly.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0033565	ESCRT-0 complex	A protein complex required for the recycling of Golgi proteins, formation of lumenal membranes and sorting of ubiquitinated proteins into those membranes. This complex includes Vps1p and Hse1p in yeast and the Hrs and STAM proteins in mammals.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain H (HGS_HUMAN | O14964)

molecular function
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
biological process
	GO:0006914	autophagy	The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
	GO:0016197	endosomal transport	The directed movement of substances into, out of, or mediated by an endosome, a membrane-bounded organelle that carries materials newly ingested by endocytosis. It passes many of the materials to lysosomes for degradation.
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0010324	membrane invagination	The infolding of a membrane.
	GO:0036258	multivesicular body assembly	The aggregation, arrangement and bonding together of a set of components to form a multivesicular body, a type of late endosome in which regions of the limiting endosomal membrane invaginate to form internal vesicles; membrane proteins that enter the internal vesicles are sequestered from the cytoplasm.
	GO:0046426	negative regulation of JAK-STAT cascade	Any process that stops, prevents, or reduces the frequency, rate or extent of the JAK-STAT signaling pathway activity.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
	GO:1903543	positive regulation of exosomal secretion	Any process that activates or increases the frequency, rate or extent of exosomal secretion.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0072657	protein localization to membrane	A process in which a protein is transported to, or maintained in, a specific location in a membrane.
	GO:0006622	protein targeting to lysosome	The process of directing proteins towards the lysosome using signals contained within the protein.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0043405	regulation of MAP kinase activity	Any process that modulates the frequency, rate or extent of MAP kinase activity.
	GO:0042176	regulation of protein catabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0033565	ESCRT-0 complex	A protein complex required for the recycling of Golgi proteins, formation of lumenal membranes and sorting of ubiquitinated proteins into those membranes. This complex includes Vps1p and Hse1p in yeast and the Hrs and STAM proteins in mammals.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005769	early endosome	A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0032585	multivesicular body membrane	The lipid bilayer surrounding a multivesicular body.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3f1i)

	Sites
(no "Sites" information available for 3f1i)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3f1i)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3f1i
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HGS_HUMAN \| O14964
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	STAM1_HUMAN \| Q92783
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HGS_HUMAN \| O14964
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	STAM1_HUMAN \| Q92783
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	HGS_HUMAN \| O14964	:	2d3g 3obq 3zyq 4avx
	STAM1_HUMAN \| Q92783	:	2l0a 3ldz

(no "Related Entries Specified in the PDB File" available for 3F1I)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (2, 2)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (33, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File