3EU7 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF A PALB2 / BRCA2 COMPLEX

Authors :   A. W. Oliver, L. H. Pearl

Date :   09 Oct 08 (Deposition) - 28 Jul 09 (Release) - 12 Nov 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym./Biol. Unit : A,X

Keywords :   Wd40 Domain, Beta Propeller, Protein-Peptide Complex, Fanconi Anemia, Nucleus, Phosphoprotein, Wd Repeat, Disease Mutation, Dna Damage, Dna Repair, Transcription-Antitumor Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. W. Oliver, S. Swift, C. J. Lord, A. Ashworth, L. H. Pearl
Structural Basis For Recruitment Of Brca2 By Palb2
Embo Rep. V. 10 990 2009
PubMed-ID: 19609323 | Reference-DOI: 10.1038/EMBOR.2009.126

Molecule 1 - PARTNER AND LOCALIZER OF BRCA2
	Chains	:	A
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Plasmid	:	PTWO-B
	Expression System Strain	:	SF9
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	C-TERMINAL WD40 DOMAIN, RESIDUES 835-1186
	Gene	:	PALB2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PALB2, FANCONI ANEMIA GROUP N PROTEIN

Molecule 2 - 19MERIC PEPTIDE FROM BREAST CANCER TYPE 2 SUSCEPTIBILITY PROTEIN
	Chains	:	X
	Engineered	:	YES
	Fragment	:	INTERACTION WITH PALB2, RESIDUES 21-39
	Other Details	:	CHEMICALLY SYNTHESIZED; THIS SEQUENCE OCCURS NATURALLY IN HUMANS
	Synonym	:	BRCA2, FANCONI ANEMIA GROUP D1 PROTEIN
	Synthetic	:	YES

		1	2
Asymmetric/Biological Unit	:	A	X

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 3)

No.	Name	Count	Type	Full Name
1	CSD	1	Mod. Amino Acid	3-SULFINOALANINE
2	GOL	2	Ligand/Ion	GLYCEROL

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:874 , PRO A:885 , CYS A:886 , SER A:1165 , THR A:1167 , ASP A:1168 , HIS A:1170	BINDING SITE FOR RESIDUE GOL A 1
2	AC2	SOFTWARE	ARG A:942 , GLU A:943 , SER A:963 , ASN A:1003 , HOH A:1217	BINDING SITE FOR RESIDUE GOL A 2

(no "SS Bond" information available for 3EU7)

Asymmetric/Biological Unit

No.	Residues
1	Ser A:1054	-	Tyr A:1055
2	Tyr A:1055	-	Gln A:1056
3	Ala A:1057	-	Ser A:1058
4	Asp A:1177	-	Gly A:1178

Asymmetric/Biological Unit (17, 17)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_028167	G	25	R	BRCA2_HUMAN	Disease (BC)	---	X	G	25	R
02	UniProt	VAR_028168	W	31	C	BRCA2_HUMAN	Disease (BC)	---	X	W	31	C
03	UniProt	VAR_028169	W	31	R	BRCA2_HUMAN	Disease (BC)	---	X	W	31	R
04	UniProt	VAR_005085	F	32	L	BRCA2_HUMAN	Disease (BC)	---	X	F	32	L
05	UniProt	VAR_054150	P	864	S	PALB2_HUMAN	Polymorphism	45568339	A	P	864	S
06	UniProt	VAR_066373	V	917	A	PALB2_HUMAN	Polymorphism	763645981	A	V	917	A
07	UniProt	VAR_066374	V	932	M	PALB2_HUMAN	Polymorphism	45624036	A	V	932	M
08	UniProt	VAR_066375	L	939	W	PALB2_HUMAN	Polymorphism	45478192	A	L	939	W
09	UniProt	VAR_066376	I	966	V	PALB2_HUMAN	Polymorphism	786204248	A	I	966	V
10	UniProt	VAR_066377	G	998	E	PALB2_HUMAN	Polymorphism	45551636	A	G	998	E
11	UniProt	VAR_066378	A	1025	T	PALB2_HUMAN	Polymorphism	746872839	A	A	1025	T
12	UniProt	VAR_066379	G	1043	A	PALB2_HUMAN	Polymorphism	377713277	A	G	1043	A
13	UniProt	VAR_066380	S	1075	G	PALB2_HUMAN	Polymorphism	---	A	S	1075	G
14	UniProt	VAR_066381	V	1105	A	PALB2_HUMAN	Polymorphism	---	A	V	1105	A
15	UniProt	VAR_066382	Q	1114	H	PALB2_HUMAN	Polymorphism	---	A	Q	1114	H
16	UniProt	VAR_066383	L	1143	P	PALB2_HUMAN	Polymorphism	62625284	A	L	1143	P
17	UniProt	VAR_066384	H	1170	Y	PALB2_HUMAN	Polymorphism	200283306	A	H	1170	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3EU7)

Asymmetric/Biological Unit (1, 1)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000380152	1a	ENSE00001184784	chr13:32889611-32889804	194	BRCA2_HUMAN	-	0	0	-	-
1.2	ENST00000380152	2	ENSE00001484009	chr13:32890559-32890664	106	BRCA2_HUMAN	1-23	23	0	-	-
1.3a	ENST00000380152	3a	ENSE00000939160	chr13:32893214-32893462	249	BRCA2_HUMAN	23-106	84	1	X:24-37	14
1.4	ENST00000380152	4	ENSE00000939161	chr13:32899213-32899321	109	BRCA2_HUMAN	106-142	37	0	-	-
1.5	ENST00000380152	5	ENSE00000939162	chr13:32900238-32900287	50	BRCA2_HUMAN	142-159	18	0	-	-
1.6	ENST00000380152	6	ENSE00000939163	chr13:32900379-32900419	41	BRCA2_HUMAN	159-172	14	0	-	-
1.7	ENST00000380152	7	ENSE00000939164	chr13:32900636-32900750	115	BRCA2_HUMAN	173-211	39	0	-	-
1.8	ENST00000380152	8	ENSE00000939165	chr13:32903580-32903629	50	BRCA2_HUMAN	211-227	17	0	-	-
1.9	ENST00000380152	9	ENSE00000939166	chr13:32905056-32905167	112	BRCA2_HUMAN	228-265	38	0	-	-
1.10b	ENST00000380152	10b	ENSE00000939167	chr13:32906409-32907524	1116	BRCA2_HUMAN	265-637	373	0	-	-
1.11	ENST00000380152	11	ENSE00000939168	chr13:32910402-32915333	4932	BRCA2_HUMAN	637-2281	1645	0	-	-
1.12	ENST00000380152	12	ENSE00000939169	chr13:32918695-32918790	96	BRCA2_HUMAN	2281-2313	33	0	-	-
1.13	ENST00000380152	13	ENSE00000939171	chr13:32920964-32921033	70	BRCA2_HUMAN	2313-2336	24	0	-	-
1.14	ENST00000380152	14	ENSE00000939173	chr13:32928998-32929425	428	BRCA2_HUMAN	2336-2479	144	0	-	-
1.15	ENST00000380152	15	ENSE00000939174	chr13:32930565-32930746	182	BRCA2_HUMAN	2479-2539	61	0	-	-
1.16	ENST00000380152	16	ENSE00000939175	chr13:32931879-32932066	188	BRCA2_HUMAN	2540-2602	63	0	-	-
1.17	ENST00000380152	17	ENSE00001394102	chr13:32936660-32936830	171	BRCA2_HUMAN	2602-2659	58	0	-	-
1.18	ENST00000380152	18	ENSE00000939177	chr13:32937316-32937670	355	BRCA2_HUMAN	2659-2777	119	0	-	-
1.19	ENST00000380152	19	ENSE00000939178	chr13:32944539-32944694	156	BRCA2_HUMAN	2778-2829	52	0	-	-
1.20a	ENST00000380152	20a	ENSE00000939180	chr13:32945093-32945237	145	BRCA2_HUMAN	2830-2878	49	0	-	-
1.22	ENST00000380152	22	ENSE00000939181	chr13:32950807-32950928	122	BRCA2_HUMAN	2878-2918	41	0	-	-
1.23b	ENST00000380152	23b	ENSE00000939183	chr13:32953454-32953652	199	BRCA2_HUMAN	2919-2985	67	0	-	-
1.24a	ENST00000380152	24a	ENSE00000939185	chr13:32953887-32954050	164	BRCA2_HUMAN	2985-3039	55	0	-	-
1.25	ENST00000380152	25	ENSE00000939187	chr13:32954144-32954282	139	BRCA2_HUMAN	3040-3086	47	0	-	-
1.26	ENST00000380152	26	ENSE00000939189	chr13:32968826-32969070	245	BRCA2_HUMAN	3086-3167	82	0	-	-
1.28b	ENST00000380152	28b	ENSE00000939192	chr13:32971035-32971181	147	BRCA2_HUMAN	3168-3216	49	0	-	-
1.29c	ENST00000380152	29c	ENSE00001184789	chr13:32972299-32973347	1049	BRCA2_HUMAN	3217-3418	202	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:313
 aligned with PALB2_HUMAN | Q86YC2 from UniProtKB/Swiss-Prot  Length:1186

    Alignment length:333
                                   863       873       883       893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143      1153      1163      1173      1183   
         PALB2_HUMAN    854 NLQLVSELKNPSGSCSVDVSAMFWERAGCKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSSDDESEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPCAKESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS 1186
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.......eeeeeeee..--....eeeeeee..eeeeeee.....eeeeeeee.....eeeee........eeeee....eeeeeeee.-----..eeeeeeeeeeeeeeee...eeeeee......eeeeeee.--..eeeeeee......eeeeeeee....eeeeee...eeeeee.....eeeeee.........eeeeeee..eeeeeee.-----------..eeeeee......eeeeeee.........eeeeeee..eeeeee....eeeee.....eeeee.........eeee.....eeeee.....eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------S----------------------------------------------------A--------------M------W--------------------------V-------------------------------E--------------------------T-----------------A-------------------------------G-----------------------------A--------H----------------------------P--------------------------Y---------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3eu7 A  854 NLQLVSELKNPSGSCSVDVSAMFWE--GCKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFC-----SEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFA--GGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSH-----------PVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHcAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS 1186
                                   863       873    |  883       893       903       913       923       933       943     |   - |     963       973       983       993 |  | 1003      1013      1023      1033      1043      1053      1063      1073  |      -    | 1093      1103      1113      1123   |  1133      1143      1153      1163      1173      1183   
                                                  878  |                                                                 949   955                                     995  |                                                                          1076        1088                                   1127-CSD                                                       
                                                     881                                                                                                                  998

Chain X from PDB  Type:PROTEIN  Length:14
 aligned with BRCA2_HUMAN | P51587 from UniProtKB/Swiss-Prot  Length:3418

    Alignment length:14
                                    33    
         BRCA2_HUMAN     24 LGPISLNWFEELSS   37
               SCOP domains -------------- SCOP domains
               CATH domains -------------- CATH domains
               Pfam domains -------------- Pfam domains
         Sec.struct. author ......hhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -R-----CL----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------R------ SAPs(SNPs) (2)
                    PROSITE -------------- PROSITE
               Transcript 1 Exon 1.3a      Transcript 1
                3eu7 X   24 LGPISLNWFEELSS   37
                                    33

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3EU7)

(no "CATH Domain" information available for 3EU7)

(no "Pfam Domain" information available for 3EU7)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PALB2_HUMAN | Q86YC2)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006310	DNA recombination	Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0000731	DNA synthesis involved in DNA repair	Synthesis of DNA that proceeds from the broken 3' single-strand DNA end and uses the homologous intact duplex as the template.
	GO:0009887	animal organ morphogenesis	Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0031052	chromosome breakage	Regulated cleavage of the developing macronuclear genome at a limited number of chromosome breakage sites (CBS). The macronuclear destined segment (MDS) sequence adjacent to the CBS (or separated from it by a BES) receives a macronuclear telomere following chromosome breakage.
	GO:0000724	double-strand break repair via homologous recombination	The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
	GO:0048568	embryonic organ development	Development, taking place during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Development pertains to the process whose specific outcome is the progression of a structure over time, from its formation to the mature structure. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
	GO:0001701	in utero embryonic development	The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
	GO:0001833	inner cell mass cell proliferation	The proliferation of cells in the inner cell mass.
	GO:0007498	mesoderm development	The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue.
	GO:0035264	multicellular organism growth	The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0036342	post-anal tail morphogenesis	The process in which a post-anal tail is generated and organized. A post-anal tail is a muscular region of the body that extends posterior to the anus. The post-anal tail may aid locomotion and balance.
	GO:0001756	somitogenesis	The formation of mesodermal clusters that are arranged segmentally along the anterior posterior axis of an embryo.
	GO:0000732	strand displacement	The rejection of the broken 3' single-strand DNA molecule that formed heteroduplex DNA with its complement in an intact duplex DNA. The Watson-Crick base pairing in the original duplex is restored. The rejected 3' single-strand DNA molecule reanneals with its original complement to reform two intact duplex molecules.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain X (BRCA2_HUMAN | P51587)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0010484	H3 histone acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + histone H3 = CoA + acetyl-histone H3.
	GO:0010485	H4 histone acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + histone H4 = CoA + acetyl-histone H4.
	GO:0043015	gamma-tubulin binding	Interacting selectively and non-covalently with the microtubule constituent protein gamma-tubulin.
	GO:0004402	histone acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + histone = CoA + acetyl-histone.
	GO:0002020	protease binding	Interacting selectively and non-covalently with any protease or peptidase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003697	single-stranded DNA binding	Interacting selectively and non-covalently with single-stranded DNA.
biological process
	GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, resulting in the induction of the transcription of p21 (also known as WAF1, CIP1 and SDI1) or any equivalent protein, in response to the detection of DNA damage.
	GO:0006310	DNA recombination	Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0000731	DNA synthesis involved in DNA repair	Synthesis of DNA that proceeds from the broken 3' single-strand DNA end and uses the homologous intact duplex as the template.
	GO:0007420	brain development	The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
	GO:0007569	cell aging	An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0051298	centrosome duplication	The replication of a centrosome, a structure comprised of a pair of centrioles and peri-centriolar material from which a microtubule spindle apparatus is organized.
	GO:0043009	chordate embryonic development	The process whose specific outcome is the progression of the embryo over time, from zygote formation through a stage including a notochord and neural tube until birth or egg hatching.
	GO:0031052	chromosome breakage	Regulated cleavage of the developing macronuclear genome at a limited number of chromosome breakage sites (CBS). The macronuclear destined segment (MDS) sequence adjacent to the CBS (or separated from it by a BES) receives a macronuclear telomere following chromosome breakage.
	GO:0051276	chromosome organization	A process that is carried out at the cellular level that results in the assembly, arrangement of constituent parts, or disassembly of chromosomes, structures composed of a very long molecule of DNA and associated proteins that carries hereditary information. This term covers covalent modifications at the molecular level as well as spatial relationships among the major components of a chromosome.
	GO:0000910	cytokinesis	The division of the cytoplasm and the plasma membrane of a cell and its partitioning into two daughter cells.
	GO:0006302	double-strand break repair	The repair of double-strand breaks in DNA via homologous and nonhomologous mechanisms to reform a continuous DNA helix.
	GO:0000724	double-strand break repair via homologous recombination	The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
	GO:0070200	establishment of protein localization to telomere	The directed movement of a protein to a specific location in the telomeric region of a chromosome.
	GO:0008585	female gonad development	The process whose specific outcome is the progression of the female gonad over time, from its formation to the mature structure.
	GO:0030097	hemopoiesis	The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
	GO:0043966	histone H3 acetylation	The modification of histone H3 by the addition of an acetyl group.
	GO:0043967	histone H4 acetylation	The modification of histone H4 by the addition of an acetyl group.
	GO:0031619	homologous chromosome orientation involved in meiotic metaphase I plate congression	The cell cycle process in which the sister centromeres of one chromosome attach to microtubules that emanate from the same spindle pole, which ensures that homologous maternal and paternal chromosomes are pulled in opposite directions at anaphase of meiosis I.
	GO:0001833	inner cell mass cell proliferation	The proliferation of cells in the inner cell mass.
	GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
	GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
	GO:0007141	male meiosis I	A cell cycle process comprising the steps by which a cell progresses through male meiosis I, the first meiotic division in the male germline.
	GO:0030879	mammary gland development	The process whose specific outcome is the progression of the mammary gland over time, from its formation to the mature structure. The mammary gland is a large compound sebaceous gland that in female mammals is modified to secrete milk. Its development starts with the formation of the mammary line and ends as the mature gland cycles between nursing and weaning stages.
	GO:1990426	mitotic recombination-dependent replication fork processing	Replication fork processing that includes recombination between DNA near the arrested fork and homologous sequences. Proteins involved in homologous recombination are required for replication restart.
	GO:0035264	multicellular organism growth	The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
	GO:0033600	negative regulation of mammary gland epithelial cell proliferation	Any process that stops, prevents or reduces the rate or extent of mammary gland epithelial cell proliferation.
	GO:0006289	nucleotide-excision repair	A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
	GO:0001556	oocyte maturation	A developmental process, independent of morphogenetic (shape) change, that is required for an oocyte to attain its fully functional state. Oocyte maturation commences after reinitiation of meiosis commonly starting with germinal vesicle breakdown, and continues up to the second meiotic arrest prior to fertilization.
	GO:0045931	positive regulation of mitotic cell cycle	Any process that activates or increases the rate or extent of progression through the mitotic cell cycle.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0032465	regulation of cytokinesis	Any process that modulates the frequency, rate or extent of the division of the cytoplasm of a cell and its separation into two daughter cells.
	GO:0048478	replication fork protection	Any process that prevents the collapse of stalled replication forks.
	GO:0010225	response to UV-C	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-C radiation stimulus. UV-C radiation (UV-C light) spans the wavelengths 100 to 280 nm.
	GO:0010165	response to X-ray	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of X-ray radiation. An X-ray is a form of electromagnetic radiation with a wavelength in the range of 10 nanometers to 100 picometers (corresponding to frequencies in the range 30 PHz to 3 EHz).
	GO:0032355	response to estradiol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0010332	response to gamma radiation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
	GO:0007584	response to nutrient	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
	GO:0000732	strand displacement	The rejection of the broken 3' single-strand DNA molecule that formed heteroduplex DNA with its complement in an intact duplex DNA. The Watson-Crick base pairing in the original duplex is restored. The rejected 3' single-strand DNA molecule reanneals with its original complement to reform two intact duplex molecules.
	GO:0000722	telomere maintenance via recombination	Any recombinational process that contributes to the maintenance of proper telomeric length.
cellular component
	GO:0033593	BRCA2-MAGE-D1 complex	A heterodimeric protein complex formed of BRCA2 and MAGE-D1; may mediate the synergistic activities of the two proteins in regulating cell growth.
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0000784	nuclear chromosome, telomeric region	The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0030141	secretory granule	A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CSD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:1057 - Ser A:1058	[ RasMol ]
		Asp A:1177 - Gly A:1178	[ RasMol ]
		Ser A:1054 - Tyr A:1055	[ RasMol ]
		Tyr A:1055 - Gln A:1056	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3eu7
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BRCA2_HUMAN \| P51587
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PALB2_HUMAN \| Q86YC2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	114480
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BRCA2_HUMAN \| P51587
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PALB2_HUMAN \| Q86YC2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	BRCA2_HUMAN \| P51587	:	1n0w
	PALB2_HUMAN \| Q86YC2	:	2w18

(no "Related Entries Specified in the PDB File" available for 3EU7)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (17, 17)

PROSITE Motifs (0, 0)

Exons (1, 1)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (69, 82)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File