Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE AHSA1 (SPO3351) PROTEIN FROM SILICIBACTER POMEROYI, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET SIR160
 
Authors :  F. Forouhar, M. Su, J. Seetharaman, H. Janjua, R. Xiao, C. Ciccosanti, E. L. Foote, D. Wang, S. Tong, J. K. Everett, T. B. Acton, G. T. Montelione, J. F. Hunt, L. Tong, Northeast Structural Genomics Consortium (Nesg)
Date :  22 Sep 08  (Deposition) - 30 Sep 08  (Release) - 20 Oct 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Alpha-Beta Protein, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Forouhar, M. Su, J. Seetharaman, H. Janjua, R. Xiao, C. Ciccosanti, E. L. Foote, D. Wang, S. Tong, J. K. Everett, T. B. Acton, G. T. Montelione, J. F. Hunt, L. Tong
Crystal Structure Of The Ahsa1 (Spo3351) Protein From Silicibacter Pomeroyi, Northeast Structural Genomics Consortium Target Sir160
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - AHA1 DOMAIN PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21
    Expression System Strain: BL21(DE3)+MAGIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: SPO3351
    Organism Scientific: SILICIBACTER POMEROYI
    Organism Taxid: 89184
    Strain: DSS-3
    Synonym: AHSA1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric/Biological Unit (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3ELI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3ELI)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3ELI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3ELI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3ELI)

(-) Exons   (0, 0)

(no "Exon" information available for 3ELI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:144
 aligned with Q5LN61_RUEPO | Q5LN61 from UniProtKB/TrEMBL  Length:144

    Alignment length:146
                                                                                                                                                                        144   
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141  |   
         Q5LN61_RUEPO     2 ADLRLEREFAVAPEALFAWVSDGAKLLQWWGPEGLHVPADQHDLDFTRLGPWFSVMVNGEGQRYKVSGQVTHVKPPQSVGFTWGWHDDDDRRGAESHVMFIVEPCAKGARLILDHRELGDDEMSLRHEEGWTSSLRKLAAELA---   -
               SCOP domains d3elia1 A:2-144 Uncharacterized protein SPO3351                                                                                                --- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..hhhhhhhhh.hhhhhhhhh...................eeeeeeee.....eeeeeeeeeeee...eeeeeeeee.....eeeeeeeeee....--.eeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3eli A   2 ADLRLEREFAVAPEALFAWVSDGAKLLQWWGPEGLHVPADQHDLDFTRLGPWFSVmVNGEGQRYKVSGQVTHVKPPQSVGFTWGWHDDDDRRGAESHVmFIVEPC--GARLILDHRELGDDEmSLRHEEGWTSSLRKLAAELALEH 147
                                    11        21        31        41        51     |  61        71        81        91       101    |  111       121  |    131       141      
                                                                                  57-MSE                                    100-MSE06  |            124-MSE                   
                                                                                                                                     109
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3ELI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3ELI)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q5LN61_RUEPO | Q5LN61)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:0006950    response to stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3eli)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3eli)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3eli
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5LN61_RUEPO | Q5LN61
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5LN61_RUEPO | Q5LN61
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3ELI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3ELI)