Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF UDP-GLUCOSE 4 EPIMERASE (GALE-1) FROM ARCHAEOGLOBUS FULGIDUS
 
Authors :  R. Agarwal, S. K. Burley, S. Swaminathan, New York Sgx Research Cen Structural Genomics (Nysgxrc)
Date :  12 Sep 08  (Deposition) - 14 Oct 08  (Release) - 09 Feb 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.87
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A  (1x)
Biol. Unit 3:  B  (1x)
Keywords :  Psi-Ii, Nysgxrc, 11140G, Gale-1, Udp-Glucose 4 Epimerase, Structural Genomics, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Agarwal, S. K. Burley, S. Swaminathan
Crystal Structure Of Gale-1 From Archaeoglobus Fulgidus
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPSGX3(BC)
    Expression System StrainBL21 DE3(RIPL)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneAF_0361
    Organism ScientificARCHAEOGLOBUS FULGIDUS
    Organism Taxid2234
    StrainDSM 4304

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (1x)A 
Biological Unit 3 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1NAD1Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1NAD1Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:8 , GLY A:11 , PHE A:12 , ILE A:13 , ASP A:31 , ASN A:32 , LEU A:33 , SER A:34 , SER A:35 , GLY A:36 , ALA A:50 , ASP A:51 , LEU A:52 , ILE A:70 , ALA A:71 , ALA A:72 , ASN A:89 , THR A:112 , SER A:113 , TYR A:138 , LYS A:142 , PHE A:165 , ALA A:166 , ASN A:167 , VAL A:168 , HOH A:902 , HOH A:905 , HOH A:913 , HOH A:921 , HOH A:939BINDING SITE FOR RESIDUE NAD A 900
2AC2SOFTWAREGLY B:8 , ALA B:10 , GLY B:11 , PHE B:12 , ILE B:13 , ASP B:31 , ASN B:32 , LEU B:33 , SER B:34 , SER B:35 , GLY B:36 , ALA B:50 , ASP B:51 , LEU B:52 , ILE B:70 , ALA B:71 , ALA B:72 , ASN B:89 , THR B:112 , SER B:113 , TYR B:138 , LYS B:142 , PHE B:165 , ASN B:167 , VAL B:168 , HIS B:175 , HOH B:903 , HOH B:905 , HOH B:945 , HOH B:981BINDING SITE FOR RESIDUE NAD B 901

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3EHE)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Ile A:124 -Pro A:125
2Ile B:124 -Pro B:125

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3EHE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3EHE)

(-) Exons   (0, 0)

(no "Exon" information available for 3EHE)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:290
 aligned with O29886_ARCFU | O29886 from UniProtKB/TrEMBL  Length:305

    Alignment length:303
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300   
         O29886_ARCFU     1 MIVVTGGAGFIGSHVVDKLSESNEIVVIDNLSSGNEEFVNEAARLVKADLAADDIKDYLKGAEEVWHIAANPDVRIGAENPDEIYRNNVLATYRLLEAMRKAGVSRIVFTSTSTVYGEAKVIPTPEDYPTHPISLYGASKLACEALIESYCHTFDMQAWIYRFANVIGRRSTHGVIYDFIMKLKRNPEELEILGNGEQNKSYIYISDCVDAMLFGLRGDERVNIFNIGSEDQIKVKRIAEIVCEELGLSPRFRFTGGDRGWKGDVPVMLLSIEKLKRLGWKPRYNSEEAVRMAVRDLVEDLDE 303
               SCOP domains d3ehea_ A: automated matches                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...hhhhhhhhhhhh....eeee......hhhhh...eeee........hhhhhh...eeee........-...hhhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhh................hhhhhhhhhhhhhhhhhhhhh..eeeeee...ee......hhhhhhhhhhhhh..eeeee.....ee..eehhhhhhhhhhhh.....eeeee......eehhhhhhhhhhhh....eeeee------------....hhhhhhhh.....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ehe A   3 LIVVTGGAGFIGSHVVDKLSESNEIVVIDNLSSGNEEFVNEAARLVKADLAADDIKDYLKGAEEVWHIAANPDVR-GAENPDEIYRNNVLATYRLLEAMRKAGVSRIVFTSTSTVYGEAKVIPTPEDYPTHPISLYGASKLACEALIESYCHTFDMQAWIYRFANVIGRRSTHGVIYDFIMKLKRNPEELEILGNGEQNKSYIYISDCVDAMLFGLRGDERVNIFNIGSEDQIKVKRIAEIVCEELGLSPRFRFT------------MLLSIEKLKRLGWKPRYNSEEAVRMAVRDLVEDLDE 305
                                    12        22        32        42        52        62        72    | | 82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252    |    -       272       282       292       302   
                                                                                                     77 |                                                                                                                                                                               257          270                                   
                                                                                                       79                                                                                                                                                                                                                                  

Chain B from PDB  Type:PROTEIN  Length:290
 aligned with O29886_ARCFU | O29886 from UniProtKB/TrEMBL  Length:305

    Alignment length:303
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300   
         O29886_ARCFU     1 MIVVTGGAGFIGSHVVDKLSESNEIVVIDNLSSGNEEFVNEAARLVKADLAADDIKDYLKGAEEVWHIAANPDVRIGAENPDEIYRNNVLATYRLLEAMRKAGVSRIVFTSTSTVYGEAKVIPTPEDYPTHPISLYGASKLACEALIESYCHTFDMQAWIYRFANVIGRRSTHGVIYDFIMKLKRNPEELEILGNGEQNKSYIYISDCVDAMLFGLRGDERVNIFNIGSEDQIKVKRIAEIVCEELGLSPRFRFTGGDRGWKGDVPVMLLSIEKLKRLGWKPRYNSEEAVRMAVRDLVEDLDE 303
               SCOP domains d3eheb_ B: automated matches                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee...hhhhhhhhhhhhh...eeeee.....hhhhh....eeee.......hhhhhh...eeee........-...hhhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhh................hhhhhhhhhhhhhhhhhhhhhh.eeeeee...ee......hhhhhhhhhhh....eeeee.....ee..eehhhhhhhhhhhh.....eeeee......eehhhhhhhhhhhhh...eeeee------------....hhhhhhh......hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ehe B   3 LIVVTGGAGFIGSHVVDKLSESNEIVVIDNLSSGNEEFVNEAARLVKADLAADDIKDYLKGAEEVWHIAANPDVR-GAENPDEIYRNNVLATYRLLEAMRKAGVSRIVFTSTSTVYGEAKVIPTPEDYPTHPISLYGASKLACEALIESYCHTFDMQAWIYRFANVIGRRSTHGVIYDFIMKLKRNPEELEILGNGEQNKSYIYISDCVDAMLFGLRGDERVNIFNIGSEDQIKVKRIAEIVCEELGLSPRFRFT------------MLLSIEKLKRLGWKPRYNSEEAVRMAVRDLVEDLDE 305
                                    12        22        32        42        52        62        72    | | 82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252    |    -       272       282       292       302   
                                                                                                     77 |                                                                                                                                                                               257          270                                   
                                                                                                       79                                                                                                                                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3EHE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3EHE)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (O29886_ARCFU | O29886)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0050662    coenzyme binding    Interacting selectively and non-covalently with a coenzyme, any of various nonprotein organic cofactors that are required, in addition to an enzyme and a substrate, for an enzymatic reaction to proceed.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ile A:124 - Pro A:125   [ RasMol ]  
    Ile B:124 - Pro B:125   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ehe
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O29886_ARCFU | O29886
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O29886_ARCFU | O29886
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3EHE)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3EHE)