Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF THE GAF DOMAIN/HD DOMAIN PROTEIN FROM GEOBACTER SULFURREDUCENS
 
Authors :  R. Zhang, C. Hatzos, S. Clancy, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  04 Sep 08  (Deposition) - 04 Nov 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Gaf Domain/Hd Domain Protein, Structural Genomics, Psi, Mcsg, Protein Structure Initiative, Midwest Center For Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Zhang, C. Hatzos, S. Clancy, A. Joachimiak
The Crystal Structure Of The Gaf Domain/Hd Domain Protein From Geobacter Sulfurreducens
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GAF DOMAIN/HD DOMAIN PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: GSU1007
    Organism Scientific: GEOBACTER SULFURREDUCENS
    Organism Taxid: 35554
    Strain: PCA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1PG62Ligand/Ion1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:32 , TRP A:33 , TYR A:37 , LEU A:54 , PHE A:58 , MET A:65 , ILE A:72 , LEU A:74 , LEU A:103BINDING SITE FOR RESIDUE PG6 A 163
2AC2SOFTWAREARG B:32 , TRP B:33 , TYR B:37 , PHE B:58 , LEU B:103 , PHE B:125 , HOH B:242 , HOH B:254BINDING SITE FOR RESIDUE PG6 B 163

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3EEA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3EEA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3EEA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3EEA)

(-) Exons   (0, 0)

(no "Exon" information available for 3EEA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:153
 aligned with Q74EF5_GEOSL | Q74EF5 from UniProtKB/TrEMBL  Length:550

    Alignment length:155
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162     
         Q74EF5_GEOSL    13 ERLSGLTDVDEVIKDLSRLLRKLVKTRWIAVYFFDRERRDFAPARSTGLPASFLPVFREMPLAPDKIPLLKSMLRKRQHLMLTDPGSSDLLTPKLRKLLRNLCVLAVPMVVRTQVIGAVFMARTRDNPPFSDAETAIIRDLVSHAALVVSHMQLF 167
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3eeaA00 A:6-160  [code=3.30.450.40,   no name defined]                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.--...eeeeeee..hhhhhhhhhhh......hhhhhhhhhhh..eee.hhhhh...hhhhhhhh..eeeeeeeeee..eeeeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3eea A   6 ERLSGLTDVDEVIKDLSRLLRKLVKTRWIAVYFFD--RRDFAPARSTGLPASFLPVFREMPLAPDKIPLLKSMLRKRQHLMLTDPGSSDLLTPKLRKLLRNLCVLAVPMVVRTQVIGAVFMARTRDNPPFSDAETAIIRDLVSHAALVVSHMQLF 160
                                    15        25        35    |  |45        55        65        75        85        95       105       115       125       135       145       155     
                                                             40 43                                                                                                                     


Chain B from PDB  Type:PROTEIN  Length:151
 aligned with Q74EF5_GEOSL | Q74EF5 from UniProtKB/TrEMBL  Length:550

    Alignment length:154
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165    
         Q74EF5_GEOSL    16 SGLTDVDEVIKDLSRLLRKLVKTRWIAVYFFDRERRDFAPARSTGLPASFLPVFREMPLAPDKIPLLKSMLRKRQHLMLTDPGSSDLLTPKLRKLLRNLCVLAVPMVVRTQVIGAVFMARTRDNPPFSDAETAIIRDLVSHAALVVSHMQLFDE 169
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3eeaB00 B:9-162  [code=3.30.450.   40, no name defined]                                                                                                    CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhh...eeeeeee.---..eeeeeee..hhhhhhhhhhh......hhhhhhhhhhh..eee.hhhhh...hhhhhhhh..eeeeeeeeee..eeeeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3eea B   9 SGLTDVDEVIKDLSRLLRKLVKTRWIAVYFFD---RDFAPARSTGLPASFLPVFREMPLAPDKIPLLKSMLRKRQHLMLTDPGSSDLLTPKLRKLLRNLCVLAVPMVVRTQVIGAVFMARTRDNPPFSDAETAIIRDLVSHAALVVSHMQLFDE 162
                                    18        28        38 |   |  48        58        68        78        88        98       108       118       128       138       148       158    
                                                          40  44
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3EEA)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3EEA)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q74EF5_GEOSL | Q74EF5)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PG6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3eea)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3eea
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q74EF5_GEOSL | Q74EF5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q74EF5_GEOSL | Q74EF5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3EEA)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3EEA)