![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3EAE) |
(no "Site" information available for 3EAE) |
(no "SS Bond" information available for 3EAE) |
(no "Cis Peptide Bond" information available for 3EAE) |
(no "SAP(SNP)/Variant" information available for 3EAE) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 3EAE) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:92 aligned with HDGR2_HUMAN | Q7Z4V5 from UniProtKB/Swiss-Prot Length:671 Alignment length:92 11 21 31 41 51 61 71 81 91 HDGR2_HUMAN 2 PHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS 93 SCOP domains d3eaea_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----PWWP PDB: A:7-64 UniProt: 7-64 ----------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 3eae A 2 PHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS 93 11 21 31 41 51 61 71 81 91 Chain B from PDB Type:PROTEIN Length:75 aligned with HDGR2_HUMAN | Q7Z4V5 from UniProtKB/Swiss-Prot Length:671 Alignment length:86 14 24 34 44 54 64 74 84 HDGR2_HUMAN 5 FKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHA 90 SCOP domains d3eaeb_ B: automated ma tches SCOP domains CATH domains -------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --PWWP PDB: B:7-64 UniProt: 7-64 -------------------------- PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 3eae B 5 FKPGDLVFAKMKGYPHWPARIDD-----------KYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHA 90 14 24 | - | 44 54 64 74 84 27 39
|
Asymmetric Unit
|
(no "CATH Domain" information available for 3EAE) |
(no "Pfam Domain" information available for 3EAE) |
Asymmetric Unit(hide GO term definitions) Chain A,B (HDGR2_HUMAN | Q7Z4V5)
|
|
|
|
|
|
|