3DP5 - JenaLib

Title :   CRYSTAL STRUCTURE OF GEOBACTER SULFURREDUCENS OMCF WITH N-TERMINAL STREP-TAG II

Authors :   P. Lukat, M. Hoffmann, O. Einsle

Date :   07 Jul 08 (Deposition) - 02 Sep 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.86

Chains :   Asym./Biol. Unit : A

Keywords :   C-Type Cytochrome, Fe Sad Phasing, Dissimilatory Metal Reduction, Geobacter Sulfurreducens, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Lukat, M. Hoffmann, O. Einsle
Crystal Packing Of The C(6)-Type Cytochrome Omcf From Geobacter Sulfurreducens Is Mediated By An N-Terminal Strep-Tag Ii
Acta Crystallogr. , Sect. D V. 64 919 2008
PubMed-ID: 18703839 | Reference-DOI: 10.1107/S0907444908021306
(for further references see the PDB file header)

Compounds

Molecule 1 - CYTOCHROME C FAMILY PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET22B(+)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 26-104, OMCF
	Gene	:	GSU2432
	Organism Scientific	:	GEOBACTER SULFURREDUCENS
	Organism Taxid	:	35554
	Strain	:	PCA
	Synonym	:	OMCF

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:56 , ALA A:59 , GLY A:83 , GLU A:84 , ALA A:85 , MET A:86 , HOH A:133 , HOH A:163 , HOH A:169 , HOH A:174 , HOH A:237	BINDING SITE FOR RESIDUE SO4 A 1
2	AC2	SOFTWARE	HIS A:-15 , HIS A:34 , CYS A:35 , CYS A:38 , HIS A:39 , ASN A:44 , HIS A:47 , LYS A:50 , LEU A:52 , ASN A:60 , ILE A:62 , TYR A:71 , PRO A:77 , GLY A:78 , MET A:79 , ILE A:95 , HOH A:129 , HOH A:136 , HOH A:144 , HOH A:195 , HOH A:217	BINDING SITE FOR RESIDUE HEM A 122

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:99
 aligned with Q74AE4_GEOSL | Q74AE4 from UniProtKB/TrEMBL  Length:104

    Alignment length:99
                                             24                                                                                
                                           23 |                                                                                
                                    16      | 25        35        45        55        65        75        85        95         
         Q74AE4_GEOSL     7 VAACMALALAAGCSGGS-GAGGGELFATHCAGCHPQGGNTVHPEKTLARARREANGIRTVRDVAAYIRNPGPGMPAFGEAMIPPADALKIGEYVVASFP 104
               SCOP domains d3dp5a_ A: automated matches                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhh....hhhhhhhhhh...hhhhh.........hhhhhhhh...hhhhhhhhh...............hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                 3dp5 A -20 AASWSHPQFEKGAETAVPNSGGGELFATHCAGCHPQGGNTVHPEKTLARARREANGIRTVRDVAAYIRNPGPGMPAFGEAMIPPADALKIGEYVVASFP 104
                                   -11        -1|       35        45        55        65        75        85        95         
                                              -1|                                                                              
                                               26

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (Q74AE4_GEOSL | Q74AE4)


GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3dp5)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3dp5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q74AE4_GEOSL \| Q74AE4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q74AE4_GEOSL \| Q74AE4
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description