![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 3) Biological Unit 1 (1, 1) Biological Unit 2 (2, 2) |
Asymmetric Unit (3, 3)
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 3CXG) |
(no "PROSITE Motif" information available for 3CXG) |
(no "Exon" information available for 3CXG) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:122 aligned with Q4VWQ3_PLAF7 | Q4VWQ3 from UniProtKB/TrEMBL Length:180 Alignment length:150 38 48 58 68 78 88 98 108 118 128 138 148 158 168 178 Q4VWQ3_PLAF7 29 SHIKKIFPSFFKNPNKEEIDKHIGNILEAKRKNKQLEQSIYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYYYVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNEWVLVHTVEGANQNDIEKAFQKYCLEK 178 SCOP domains d3cxga_ A : automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains Chain B from PDB Type:PROTEIN Length:122 aligned with Q4VWQ3_PLAF7 | Q4VWQ3 from UniProtKB/TrEMBL Length:180 Alignment length:150 38 48 58 68 78 88 98 108 118 128 138 148 158 168 178 Q4VWQ3_PLAF7 29 SHIKKIFPSFFKNPNKEEIDKHIGNILEAKRKNKQLEQSIYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYYYVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNEWVLVHTVEGANQNDIEKAFQKYCLEK 178 SCOP domains d3cxgb_ B : automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
|
Asymmetric Unit
|
(no "CATH Domain" information available for 3CXG) |
(no "Pfam Domain" information available for 3CXG) |
Asymmetric Unit(hide GO term definitions) Chain A,B (Q4VWQ3_PLAF7 | Q4VWQ3)
|
|
|
|
|
|
|