|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 3CSX) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 3CSX) |
(no "PROSITE Motif" information available for 3CSX) |
(no "Exon" information available for 3CSX) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:61 aligned with A1KYE3_CYAA5 | A1KYE3 from UniProtKB/TrEMBL Length:78 Alignment length:61 24 34 44 54 64 74 A1KYE3_CYAA5 15 ADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWEE 75 SCOP domains ------------------------------------------------------------- SCOP domains CATH domains 3csxA00 A:15-75 Helix hairpin bin CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 3csx A 15 ADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWEE 75 24 34 44 54 64 74 Chain B from PDB Type:PROTEIN Length:71 aligned with A1KYE3_CYAA5 | A1KYE3 from UniProtKB/TrEMBL Length:78 Alignment length:71 14 24 34 44 54 64 74 A1KYE3_CYAA5 5 TDNNPTPEAVADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWEE 75 SCOP domains ----------------------------------------------------------------------- SCOP domains CATH domains 3csxB00 B:5-75 Helix hairpin bin CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 3csx B 5 TDNNPTPEAVADLKKKVRKLNSKAGQMKMDLHDLAEGLPTDYENLVETAEKTYEIFRELDQLKKKLNIWEE 75 14 24 34 44 54 64 74
|
(no "SCOP Domain" information available for 3CSX) |
Asymmetric Unit |
(no "Pfam Domain" information available for 3CSX) |
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3CSX)
|
|
|
|
|
|
|