3CQC - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   NUCLEOPORIN NUP107/NUP133 INTERACTION COMPLEX

Authors :   S. Jeudy, T. Boehmer, I. Berke, T. U. Schwartz

Date :   02 Apr 08 (Deposition) - 01 Jul 08 (Release) - 23 Jan 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.53

Chains :   Asym./Biol. Unit : A,B

Keywords :   Nucleoporin, Nuclear Pore Complex, Mrna Transport, Nucleus, Phosphoprotein, Protein Transport, Translocation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Boehmer, S. Jeudy, I. C. Berke, T. U. Schwartz
Structural And Functional Studies Of Nup107/Nup133 Interaction And Its Implications For The Architecture Of Th Nuclear Pore Complex.
Mol. Cell V. 30 721 2008
PubMed-ID: 18570875 | Reference-DOI: 10.1016/J.MOLCEL.2008.04.022

Molecule 1 - NUCLEAR PORE COMPLEX PROTEIN NUP107
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX-4T2
	Expression System Strain	:	BL21(DE3)RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 658-925
	Gene	:	NUP107
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	NUCLEOPORIN NUP107, 107 KDA NUCLEOPORIN

Molecule 2 - NUCLEAR PORE COMPLEX PROTEIN NUP133
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Strain	:	BL21(DE3)RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 935-1156
	Gene	:	NUP133
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	NUCLEOPORIN NUP133, 133 KDA NUCLEOPORIN

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3CQC)

(no "Site" information available for 3CQC)

(no "SS Bond" information available for 3CQC)

(no "Cis Peptide Bond" information available for 3CQC)

Asymmetric/Biological Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_076359	D	831	A	NU107_HUMAN	Disease (NPHS11)	864321632	A	D	831	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3CQC)

Asymmetric/Biological Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000261396	1a	ENSE00001263815	chr1:229644088-229643815	274	NU133_HUMAN	1-61	61	0	-	-
1.2	ENST00000261396	2	ENSE00001069992	chr1:229641905-229641787	119	NU133_HUMAN	61-101	41	0	-	-
1.3	ENST00000261396	3	ENSE00001069983	chr1:229637849-229637746	104	NU133_HUMAN	101-135	35	0	-	-
1.4	ENST00000261396	4	ENSE00001069988	chr1:229636610-229636503	108	NU133_HUMAN	136-171	36	0	-	-
1.5	ENST00000261396	5	ENSE00001069985	chr1:229635565-229635431	135	NU133_HUMAN	172-216	45	0	-	-
1.7	ENST00000261396	7	ENSE00001069978	chr1:229634053-229633883	171	NU133_HUMAN	217-273	57	0	-	-
1.8	ENST00000261396	8	ENSE00001069994	chr1:229631794-229631639	156	NU133_HUMAN	274-325	52	0	-	-
1.9	ENST00000261396	9	ENSE00001069984	chr1:229631312-229631242	71	NU133_HUMAN	326-349	24	0	-	-
1.10	ENST00000261396	10	ENSE00001069987	chr1:229625849-229625702	148	NU133_HUMAN	349-398	50	0	-	-
1.11	ENST00000261396	11	ENSE00001015850	chr1:229623360-229623213	148	NU133_HUMAN	399-448	50	0	-	-
1.12	ENST00000261396	12	ENSE00001015859	chr1:229622275-229622118	158	NU133_HUMAN	448-500	53	0	-	-
1.13	ENST00000261396	13	ENSE00000961359	chr1:229619892-229619801	92	NU133_HUMAN	501-531	31	0	-	-
1.14	ENST00000261396	14	ENSE00000594035	chr1:229613507-229613344	164	NU133_HUMAN	531-586	56	0	-	-
1.15	ENST00000261396	15	ENSE00000793031	chr1:229611479-229611385	95	NU133_HUMAN	586-617	32	0	-	-
1.16	ENST00000261396	16	ENSE00000793030	chr1:229606551-229606327	225	NU133_HUMAN	618-692	75	0	-	-
1.17	ENST00000261396	17	ENSE00000961360	chr1:229602503-229602381	123	NU133_HUMAN	693-733	41	0	-	-
1.18	ENST00000261396	18	ENSE00000594038	chr1:229601266-229601167	100	NU133_HUMAN	734-767	34	0	-	-
1.19c	ENST00000261396	19c	ENSE00001015853	chr1:229600622-229600371	252	NU133_HUMAN	767-851	85	0	-	-
1.20	ENST00000261396	20	ENSE00000961361	chr1:229599423-229599290	134	NU133_HUMAN	851-895	45	0	-	-
1.21a	ENST00000261396	21a	ENSE00000961362	chr1:229596516-229596358	159	NU133_HUMAN	896-948	53	1	B:932-948	17
1.22	ENST00000261396	22	ENSE00000961363	chr1:229594043-229593908	136	NU133_HUMAN	949-994	46	1	B:949-994	46
1.23	ENST00000261396	23	ENSE00000961364	chr1:229588390-229588272	119	NU133_HUMAN	994-1033	40	1	B:994-1033	40
1.24c	ENST00000261396	24c	ENSE00000961365	chr1:229586352-229586272	81	NU133_HUMAN	1034-1060	27	1	B:1034-1059	26
1.25a	ENST00000261396	25a	ENSE00000961366	chr1:229584937-229584873	65	NU133_HUMAN	1061-1082	22	1	B:1064-1082	19
1.26	ENST00000261396	26	ENSE00000961367	chr1:229580749-229580661	89	NU133_HUMAN	1082-1112	31	1	B:1082-1105 (gaps)	24
1.27c	ENST00000261396	27c	ENSE00001879885	chr1:229577787-229577045	743	NU133_HUMAN	1112-1156	45	1	B:1119-1156 (gaps)	38

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:247
 aligned with NU107_HUMAN | P57740 from UniProtKB/Swiss-Prot  Length:925

    Alignment length:258
                                   676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916        
         NU107_HUMAN    667 EDRLKIDVIDWLVFDPAQRAEALKQGNAIMRKFLASKKHEAAKEVFVKIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKLLQKLRESSLMLLDQGLDPLGYEIQ  924
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..hhhhhhh-----------.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------A--------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3cqc A  667 EDRLKIDVIDWLVFDPAQRAEALKQGNAIMRKFLASKKHEAAKEVFVKIPQDSIAEIY-----------LPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKLLQKLRESSLMLLDQGLDPLGYEIQ  924
                                   676       686       696       706       716       | -       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916        
                                                                                   724         736

Chain B from PDB  Type:PROTEIN  Length:186
 aligned with NU133_HUMAN | Q8WUM0 from UniProtKB/Swiss-Prot  Length:1156

    Alignment length:225
                                   941       951       961       971       981       991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151     
         NU133_HUMAN    932 HEHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDEEEDININDLKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQI 1156
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh..........hhhhhhhhh........hhhhhhhhh.......----..hhhhhhhhhhhhhhh...-----------hhhhhhhhh..-------------.....hhhhhh-----------hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.21a       Exon 1.22  PDB: B:949-994 UniProt: 949-994    ---------------------------------------Exon 1.24c  PDB: B:1034-105Exon 1.25a            -----------------------------Exon 1.27c  PDB: B:1119-1156 (gaps)           Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------Exon 1.23  PDB: B:994-1033              ------------------------------------------------Exon 1.26 UniProt: 1082-1112   -------------------------------------------- Transcript 1 (2)
                3cqc B  932 SHMLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYID----ININDLKLEILCKALQRDNW-----------VSKDSIFVKIL-------------LPEVKDLLQAD-----------EFVLKANYEYYVQGQI 1156
                                   941       951       961       971       981       991      1001      1011      1021      1031      1041      1051       | -  |   1071      1081 |       -   |  1101   |     -      1121       | -      1141      1151     
                                                                                                                                                        1059 1064               1083        1095      1105          1119      1129        1141

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3CQC)

(no "CATH Domain" information available for 3CQC)

(no "Pfam Domain" information available for 3CQC)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (NU107_HUMAN | P57740)

molecular function
	GO:0005487	nucleocytoplasmic transporter activity	Enables the directed movement of substances between the nucleus and the cytoplasm of a cell.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0017056	structural constituent of nuclear pore	The action of a molecule that contributes to the structural integrity of the nuclear pore complex.
biological process
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0075733	intracellular transport of virus	The directed movement of a virus, or part of a virus, within the host cell.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0007077	mitotic nuclear envelope disassembly	The cell cycle process in which the controlled breakdown of the nuclear envelope during mitotic cell division occurs.
	GO:0051292	nuclear pore complex assembly	The aggregation, arrangement and bonding together of a set of components to form a nuclear pore complex.
	GO:0000973	posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery	The chromosome organization process in which the DNA sequence containing a gene transcribed by RNA polymerase II is maintained in a specific location at the nuclear periphery even after transcription has been repressed.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0016925	protein sumoylation	The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:1900034	regulation of cellular response to heat	Any process that modulates the frequency, rate or extent of cellular response to heat.
	GO:0010827	regulation of glucose transport	Any process that modulates the frequency, rate or extent of glucose transport. Glucose transport is the directed movement of the hexose monosaccharide glucose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007062	sister chromatid cohesion	The cell cycle process in which the sister chromatids of a replicated chromosome become tethered to each other.
	GO:0006409	tRNA export from nucleus	The directed movement of tRNA from the nucleus to the cytoplasm.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019083	viral transcription	The process by which a viral genome, or part of a viral genome, is transcribed within the host cell.
cellular component
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0000775	chromosome, centromeric region	The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
	GO:0000777	condensed chromosome kinetochore	A multisubunit complex that is located at the centromeric region of a condensed chromosome and provides an attachment point for the spindle microtubules.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0000776	kinetochore	A multisubunit complex that is located at the centromeric region of DNA and provides an attachment point for the spindle microtubules.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005635	nuclear envelope	The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0034399	nuclear periphery	The portion of the nuclear lumen proximal to the inner nuclear membrane.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0031080	nuclear pore outer ring	A subcomplex of the nuclear pore complex (NPC) that forms the outer rings of the core scaffold, a lattice-like structure that gives the NPC its shape and strength. In S. cerevisiae, the two outer rings each contain multiple copies of the following proteins: Nup133p, Nup120p, Nup145Cp, Nup85p, Nup84p, Seh1p, and Sec13p. In vertebrates, the two outer rings each contain multiple copies of the following proteins: Nup133, Nup160, Nup96, Nup75, Nup107, Seh1, Sec13, Nup43, Nup37, and ALADIN. Components are arranged in 8-fold symmetrical 'spokes' around the central transport channel. A single 'spoke', can be isolated and is sometimes referred to as the Nup84 complex (S. cerevisiae) or the Nup107-160 complex (vertebrates).
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (NU133_HUMAN | Q8WUM0)

molecular function
	GO:0005487	nucleocytoplasmic transporter activity	Enables the directed movement of substances between the nucleus and the cytoplasm of a cell.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0017056	structural constituent of nuclear pore	The action of a molecule that contributes to the structural integrity of the nuclear pore complex.
biological process
	GO:0006325	chromatin organization	Any process that results in the specification, formation or maintenance of the physical structure of eukaryotic chromatin.
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0075733	intracellular transport of virus	The directed movement of a virus, or part of a virus, within the host cell.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0007077	mitotic nuclear envelope disassembly	The cell cycle process in which the controlled breakdown of the nuclear envelope during mitotic cell division occurs.
	GO:0021915	neural tube development	The process whose specific outcome is the progression of the neural tube over time, from its formation to the mature structure. The mature structure of the neural tube exists when the tube has been segmented into the forebrain, midbrain, hindbrain and spinal cord regions. In addition neural crest has budded away from the epithelium.
	GO:0022008	neurogenesis	Generation of cells within the nervous system.
	GO:0031081	nuclear pore distribution	Any process that establishes the spatial arrangement of nuclear pores within the nuclear envelope.
	GO:0006999	nuclear pore organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the nuclear pore.
	GO:0048339	paraxial mesoderm development	The process whose specific outcome is the progression of the paraxial mesoderm over time, from its formation to the mature structure. The paraxial mesoderm is the mesoderm located bilaterally adjacent to the notochord and neural tube.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0016925	protein sumoylation	The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:1900034	regulation of cellular response to heat	Any process that modulates the frequency, rate or extent of cellular response to heat.
	GO:0010827	regulation of glucose transport	Any process that modulates the frequency, rate or extent of glucose transport. Glucose transport is the directed movement of the hexose monosaccharide glucose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007062	sister chromatid cohesion	The cell cycle process in which the sister chromatids of a replicated chromosome become tethered to each other.
	GO:0061053	somite development	The progression of a somite from its initial formation to the mature structure. Somites are mesodermal clusters that are arranged segmentally along the anterior posterior axis of an embryo.
	GO:0006409	tRNA export from nucleus	The directed movement of tRNA from the nucleus to the cytoplasm.
	GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	The chromosome organization process in which the DNA sequence containing a gene transcribed by RNA polymerase II is maintained in a specific location at the nuclear periphery. In S. cerevisiae, this process involves cis-acting DNA sequences such as the TATA box and upstream activating sequence (UAS) elements, trans-acting transcriptional activators, and also the 3'-UTR of the transcript.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019083	viral transcription	The process by which a viral genome, or part of a viral genome, is transcribed within the host cell.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0000775	chromosome, centromeric region	The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
	GO:0000777	condensed chromosome kinetochore	A multisubunit complex that is located at the centromeric region of a condensed chromosome and provides an attachment point for the spindle microtubules.
	GO:0000940	condensed chromosome outer kinetochore	The region of a condensed chromosome kinetochore most external to centromeric DNA; this outer region mediates kinetochore-microtubule interactions.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0000776	kinetochore	A multisubunit complex that is located at the centromeric region of DNA and provides an attachment point for the spindle microtubules.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005635	nuclear envelope	The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0031080	nuclear pore outer ring	A subcomplex of the nuclear pore complex (NPC) that forms the outer rings of the core scaffold, a lattice-like structure that gives the NPC its shape and strength. In S. cerevisiae, the two outer rings each contain multiple copies of the following proteins: Nup133p, Nup120p, Nup145Cp, Nup85p, Nup84p, Seh1p, and Sec13p. In vertebrates, the two outer rings each contain multiple copies of the following proteins: Nup133, Nup160, Nup96, Nup75, Nup107, Seh1, Sec13, Nup43, Nup37, and ALADIN. Components are arranged in 8-fold symmetrical 'spokes' around the central transport channel. A single 'spoke', can be isolated and is sometimes referred to as the Nup84 complex (S. cerevisiae) or the Nup107-160 complex (vertebrates).
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3cqc)

	Sites
(no "Sites" information available for 3cqc)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3cqc)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3cqc
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NU107_HUMAN \| P57740
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	NU133_HUMAN \| Q8WUM0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	616730
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NU107_HUMAN \| P57740
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	NU133_HUMAN \| Q8WUM0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	NU107_HUMAN \| P57740	:	3cqg 3i4r 5a9q
	NU133_HUMAN \| Q8WUM0	:	1xks 3cqg 3i4r 5a9q

(no "Related Entries Specified in the PDB File" available for 3CQC)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (0, 0)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (44, 74)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File