Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SSGA-LIKE SPORULATION-SPECIFIC CELL DIVISION PROTEIN (YP_290167.1) FROM THERMOBIFIDA FUSCA YX-ER1 AT 2.60 A RESOLUTION
 
Authors :  Joint Center For Structural Genomics (Jcsg), M. Chruszcz, W. Min
Date :  20 Mar 08  (Deposition) - 01 Apr 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Yp_290167. 1, Ssga-Like Sporulation-Specific Cell Division Protein, Streptomyces Sporulation And Cell Division Protein, Ssga, Structural Genomics, Joint Center For Structural Genomics, Jcsg, Protein Structure Initiative, Psi-2, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Q. Xu, B. A. Traag, J. Willemse, D. Mcmullan, M. D. Miller, M. A. Elsliger, P. Abdubek, T. Astakhova, H. L. Axelrod, C. Bakolitsa, D. Carlton, C. Chen, H. J. Chiu, M. Chruszcz, T. Clayton, D. Das, M. C. Deller, L. Duan, K. Ellrott, D. Ernst, C. L. Farr, J. Feuerhelm, J. C. Grant, A. Grzechnik, S. K. Grzechnik, G. W. Han, L. Jaroszewski, K. K. Jin, H. E. Klock, M. W. Knuth, P. Kozbial, S. S. Krishna, A. Kumar, D. Marciano, W. Minor, A. M. Mommaas, A. T. Morse, E. Nigoghossian, A. Nopakun, L. Okach, S. Oommachen, J. Paulsen, C. Puckett, R. Reyes, C. L. Rife, N. Sefcovic, H. J. Tien, C. B. Trame, H. Van Den Bedem, S. Wang, D. Weekes, K. O. Hodgson, J. Wooley, A. M. Deacon, A. Godzik, S. A. Lesley, I. A. Wilson, G. P. Van Wezel
Structural And Functional Characterizations Of Ssgb, A Conserved Activator Of Developmental Cell Division In Morphologically Complex Actinomycetes.
J. Biol. Chem. V. 284 25268 2009
PubMed-ID: 19567872  |  Reference-DOI: 10.1074/JBC.M109.018564

(-) Compounds

Molecule 1 - SSGA-LIKE SPORULATION-SPECIFIC CELL DIVISION PROTEIN
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: SPEEDET
    Expression System Strain: HK100
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: YP_290167.1, TFU_2111
    Organism Scientific: THERMOBIFIDA FUSCA
    Organism Taxid: 269800
    Strain: YX

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3CM1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3CM1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3CM1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3CM1)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3CM1)

(-) Exons   (0, 0)

(no "Exon" information available for 3CM1)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:137
 aligned with SSGB_THEFY | Q47N25 from UniProtKB/Swiss-Prot  Length:138

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           SSGB_THEFY     1 MSSSGTSITCEVGLQLIVPDRAPVPLVARLDYSVDDPYAIRAAFHVGDDEPVEWIFARELLTVGIIRETGEGDVRIWPSQDGKERMVNIALSSPFGQARFHAQVAPLSEFLHRTYELVPAGQESDYIDIDAEIAEHL 137
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeeeeee......eeeeeeeeee.....eeeeeee......eeeeeehhhhhhhh...eee..eeeeeeee..eeeeeeee......eeeeeehhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cm1 A   1 mSSSGTSITCEVGLQLIVPDRAPVPLVARLDYSVDDPYAIRAAFHVGDDEPVEWIFARELLTVGIIRETGEGDVRIWPSQDGKERmVNIALSSPFGQARFHAQVAPLSEFLHRTYELVPAGQESDYIDIDAEIAEHL 137
                            |       10        20        30        40        50        60        70        80     |  90       100       110       120       130       
                            |                                                                                   86-MSE                                               
                            1-MSE                                                                                                                                    


Chain B from PDB  Type:PROTEIN  Length:121
 aligned with SSGB_THEFY | Q47N25 from UniProtKB/Swiss-Prot  Length:138

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           SSGB_THEFY     1 MSSSGTSITCEVGLQLIVPDRAPVPLVARLDYSVDDPYAIRAAFHVGDDEPVEWIFARELLTVGIIRETGEGDVRIWPSQDGKERMVNIALSSPFGQARFHAQVAPLSEFLHRTYELVPAGQESDYIDIDAEIAEHL 137
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee...eeeeeeeeee.-----.eeeeeeeeee.....eeeeee..----.eeeeeehhhhhhhhhh.eee..eeeeeee..-.eeeee...------.eeeehhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cm1 B   1 mSSSGTSITCEVGLQLI-----PVPLVARLDYSVDDPYAIRAAFHV----PVEWIFARELLTVGIIRETGEGDVRIWPSQDG-ERmVNIALS------RFHAQVAPLSEFLHRTYELVPAGQESDYIDIDAEIAEHL 137
                            |       10      |  -  |     30        40     |   -|       60        70        80 | | |  90 |     100       110       120       130       
                            1-MSE          17    23                     46   51                             82 | |    92     99                                      
                                                                                                              84 |                                                   
                                                                                                                86-MSE                                               


Chain C from PDB  Type:PROTEIN  Length:126
 aligned with SSGB_THEFY | Q47N25 from UniProtKB/Swiss-Prot  Length:138

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           SSGB_THEFY     1 MSSSGTSITCEVGLQLIVPDRAPVPLVARLDYSVDDPYAIRAAFHVGDDEPVEWIFARELLTVGIIRETGEGDVRIWPSQDGKERMVNIALSSPFGQARFHAQVAPLSEFLHRTYELVPAGQESDYIDIDAEIAEHL 137
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeeeee.---...eeeeeeeeee.....eeeeee...-...eeeeeehhhhhhhh...eee..eeeeee..--..eeee....-----.eeeehhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3cm1 C   1 mSSSGTSITCEVGLQLI---RAPVPLVARLDYSVDDPYAIRAAFHVG-DEPVEWIFARELLTVGIIRETGEGDVRIWPSQD--ERmVNIALSS-----RFHAQVAPLSEFLHRTYELVPAGQESDYIDIDAEIAEHL 137
                            |       10      |  -|       30        40      | 50        60        70        80|  | |  90  |    100       110       120       130       
                            1-MSE          17  21                        47 |                              81 84 |     93    99                                      
                                                                           49                                   86-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3CM1)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3CM1)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3CM1)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (SSGB_THEFY | Q47N25)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:2000246    positive regulation of FtsZ-dependent cytokinesis    Any process that activates or increases the frequency, rate or extent of Ftsz-dependent cytokinesis.
    GO:0030435    sporulation resulting in formation of a cellular spore    The process in which a relatively unspecialized cell acquires the specialized features of a cellular spore, a cell form that can be used for dissemination, for survival of adverse conditions because of its heat and dessication resistance, and/or for reproduction.
cellular component
    GO:0030428    cell septum    A structure composed of peptidoglycan and often chitin in addition to other materials. It usually forms perpendicular to the long axis of a cell or hypha and grows centripetally from the cell wall to the center of the cell and often functions in the compartmentalization of a cell into two daughter cells.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3cm1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3cm1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3cm1
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SSGB_THEFY | Q47N25
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SSGB_THEFY | Q47N25
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3CM1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3CM1)