Chain A from PDB Type:PROTEIN Length:58
SCOP domains ---------------------------------------------------------- SCOP domains
CATH domains 3ci7A00 A:1-58 Factor Xa Inhibitor CATH domains
Pfam domains ---------------------------------------------------------- Pfam domains
Sec.struct. author .hhhhhh..........eeeeeee....eeeeeee...........hhhhhhhhhh.. Sec.struct. author
SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
PROSITE ---------------------------------------------------------- PROSITE
Transcript ---------------------------------------------------------- Transcript
3ci7 A 1 RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQAFVYGGARAKRNNFASAADALAACAAA 58
10 20 30 40 50
Chain B from PDB Type:PROTEIN Length:56
SCOP domains -------------------------------------------------------- SCOP domains
CATH domains 3ci7B00 B:1-56 Factor Xa Inhibitor CATH domains
Pfam domains -------------------------------------------------------- Pfam domains
Sec.struct. author .hhhhhh..........eeeeeee....eeeeeee...........hhhhhhhhhh Sec.struct. author
SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
PROSITE -------------------------------------------------------- PROSITE
Transcript -------------------------------------------------------- Transcript
3ci7 B 1 RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQAFVYGGARAKRNNFASAADALAACA 56
10 20 30 40 50
Chain C from PDB Type:PROTEIN Length:58
SCOP domains ---------------------------------------------------------- SCOP domains
CATH domains 3ci7C00 C:1-58 Factor Xa Inhibitor CATH domains
Pfam domains ---------------------------------------------------------- Pfam domains
Sec.struct. author .hhhhhh..........eeeeeee....eeeeeee...........hhhhhhhhhh.. Sec.struct. author
SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
PROSITE ---------------------------------------------------------- PROSITE
Transcript ---------------------------------------------------------- Transcript
3ci7 C 1 RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQAFVYGGARAKRNNFASAADALAACAAA 58
10 20 30 40 50
Chain D from PDB Type:PROTEIN Length:57
SCOP domains --------------------------------------------------------- SCOP domains
CATH domains 3ci7D00 D:1-57 Factor Xa Inhibitor CATH domains
Pfam domains --------------------------------------------------------- Pfam domains
Sec.struct. author .hhhhhh..........eeeeeee....eeeeeee...........hhhhhhhhh.. Sec.struct. author
SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
PROSITE --------------------------------------------------------- PROSITE
Transcript --------------------------------------------------------- Transcript
3ci7 D 1 RPAFCLEPPYAGPGKARIIRYFYNAAAGAAQAFVYGGARAKRNNFASAADALAACAA 57
10 20 30 40 50
| Legend: |
|
→ Mismatch |
(orange background) |
| |
- |
→ Gap |
(green background, '-', border residues have a numbering label) |
| |
|
→ Modified Residue |
(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name) |
| |
x |
→ Chemical Group |
(purple background, 'x', labelled with number + name, e.g. ACE or NH2) |
| |
extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|' |