Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE MULTIPLE PHENYLPROPENE SYNTHASES IN BOTH CLARKIA BREWERI AND PETUNIA HYBRIDA REPRESENT TWO DISTINCT LINEAGES
 
Authors :  G. V. Louie, J. P. Noel, M. E. Bowman
Date :  23 Jan 08  (Deposition) - 06 May 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Eugenol, Phenylpropene, Pip Reductase, Short-Chain Dehydrogenase/Reductase, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Koeduka, G. V. Louie, I. Orlova, C. M. Kish, M. Ibdah, C. G. Wilkerson, M. E. Bowman, T. J. Baiga, J. P. Noel, N. Dudareva, E. Pichersky
The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Protein Lineages.
Plant J. V. 54 362 2008
PubMed-ID: 18208524  |  Reference-DOI: 10.1111/J.1365-313X.2008.03412.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EUGENOL SYNTHASE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPHIS8
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneEGS1
    Organism ScientificCLARKIA BREWERI
    Organism Taxid36903
    SynonymBREWER'S CLARKIA

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1NAP1Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1NAP1Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:8 , THR A:10 , GLY A:11 , TYR A:12 , ILE A:13 , ARG A:33 , SER A:43 , ARG A:47 , ALA A:81 , LEU A:82 , PRO A:83 , PHE A:84 , MET A:86 , SER A:109 , ASP A:110 , PHE A:111 , LYS A:131 , ASN A:151 , CYS A:152 , PHE A:153 , PHE A:157 , HOH A:1001 , HOH A:1055 , HOH A:1063 , HOH A:1083 , HOH A:1088 , HOH A:1106 , HOH A:1137 , HOH A:1146BINDING SITE FOR RESIDUE NAP A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3C1O)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gln A:255 -Pro A:256

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3C1O)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3C1O)

(-) Exons   (0, 0)

(no "Exon" information available for 3C1O)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:314
 aligned with D0VWT0_CLABR | D0VWT0 from UniProtKB/TrEMBL  Length:321

    Alignment length:314
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313    
         D0VWT0_CLABR     4 MEKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPDSTPSSVQLREEFRSMGVTIIEGEMEEHEKMVSVLKQVDIVISALPFPMISSQIHIINAIKAAGNIKRFLPSDFGCEEDRIKPLPPFESVLEKKRIIRRAIEAAALPYTYVSANCFGAYFVNYLLHPSPHPNRNDDIVIYGTGETKFVLNYEEDIAKYTIKVACDPRCCNRIVIYRPPKNIISQNELISLWEAKSGLSFKKVHMPDEQLVRLSQELPQPQNIPVSILHSIFVKGDLMSYEMRKDDIEASNLYPELEFTSIDGLLDLFISGRAPPPTL 317
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3c1oA01 A:1-149,A:189-211,A:277-289 NAD(P)-binding Rossmann-like Domain                                                                              3c1oA02 A:150-188,A:212-276,A:290-314  3c1oA01                3c1oA02 A:150-188,A:212-276,A:290-314                            3c1oA01      3c1oA02                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....hhhhhhhhhhhh...eeeee.......hhhhhhhhhhhhhh..eeee....hhhhhhhhhh...eeee..hhhhhhhhhhhhhhhhhhh...eee......hhhhh..hhhhhhhhhhhhhhhhhhhhhh...eeee..eehhhhhhhhhh..........eeee.....eeeeehhhhhhhhhhhhhhhhhhh.eeee..hhh.eeehhhhhhhhhhhhh....eeeehhhhhhhhhhhh...hhhhhhhhhhhhh.............ee.hhh.......hhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3c1o A   1 MEKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPDSTPSSVQLREEFRSMGVTIIEGEMEEHEKMVSVLKQVDIVISALPFPMISSQIHIINAIKAAGNIKRFLPSDFGCEEDRIKPLPPFESVLEKKRIIRRAIEAAALPYTYVSANCFGAYFVNYLLHPSPHPNRNDDIVIYGTGETKFVLNYEEDIAKYTIKVACDPRCCNRIVIYRPPKNIISQNELISLWEAKSGLSFKKVHMPDEQLVRLSQELPQPQNIPVSILHSIFVKGDLMSYEMRKDDIEASNLYPELEFTSIDGLLDLFISGRAPPPTL 314
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3C1O)

(-) CATH Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3C1O)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A   (D0VWT0_CLABR | D0VWT0)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:255 - Pro A:256   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3c1o
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  D0VWT0_CLABR | D0VWT0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  D0VWT0_CLABR | D0VWT0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3C1O)

(-) Related Entries Specified in the PDB File

3c3x