Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CALO2
 
Authors :  J. G. Mccoy, H. D. Johnson, S. Singh, C. A. Bingman, J. S. Thorson, G. N. Ph Jr.
Date :  02 Jan 08  (Deposition) - 29 Apr 08  (Release) - 30 Jan 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.47
Chains :  Asym./Biol. Unit :  A
Keywords :  P450, Heme, Iron, Metal-Binding, Monooxygenase, Oxidoreductase, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. G. Mccoy, H. D. Johnson, S. Singh, C. A. Bingman, I. K. Lei, J. S. Thorson, G. N. Phillips Jr.
Structural Characterization Of Calo2: A Putative Orsellinic Acid P450 Oxidase In The Calicheamicin Biosynthetic Pathway
Proteins V. 74 50 2009
PubMed-ID: 18561189  |  Reference-DOI: 10.1002/PROT.22131

(-) Compounds

Molecule 1 - CALO2
    Chains: A
    Engineered: YES
    Expression System: STREPTOMYCES LIVIDANS
    Expression System Plasmid: PPW50
    Expression System Taxid: 1916
    Expression System Vector Type: PLASMID
    Gene: CALO2
    Organism Scientific: MICROMONOSPORA ECHINOSPORA
    Organism Taxid: 1877

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:48 , ARG A:55 , LEU A:80 , HIS A:87 , ARG A:91 , PHE A:98 , PHE A:230 , GLY A:234 , THR A:237 , GLN A:241 , SER A:279 , ASN A:283 , ARG A:285 , SER A:335 , PHE A:336 , GLY A:337 , ARG A:341 , CYS A:343 , GLY A:345BINDING SITE FOR RESIDUE HEM A 398

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3BUJ)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Glu A:84 -Pro A:85

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3BUJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3BUJ)

(-) Exons   (0, 0)

(no "Exon" information available for 3BUJ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:397
 aligned with Q8KND6_MICEC | Q8KND6 from UniProtKB/TrEMBL  Length:397

    Alignment length:397
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       
         Q8KND6_MICEC     1 MTAFDPTDADVRRDPYPSYHWLLRHDPVHRGAHRVWYVSRFADVRAVLGDERFARTGIRRFWTDLVGPGLLAEIVGDIILFQDEPDHGRLRGVVGPAFSPSALRRLEPVIAGTVDDLLRPALARGAMDVVDELAYPLALRAVLGLLGLPAADWGAVGRWSRDVGRTLDRGASAEDMRRGHAAIAEFADYVERALARRRREGGEDLLALMLDAHDRGLMSRNEIVSTVVTFIFTGHETVASQVGNAVLSLLAHPDQLDLLRRRPDLLAQAVEECLRYDPSVQSNTRQLDVDVELRGRRLRRDDVVVVLAGAANRDPRRYDRPDDFDIERDPVPSMSFGAGMRYCLGSYLARTQLRAAVAALARLPGLRLGCASDALAYQPRTMFRGLASLPIAFTPGG 397
               SCOP domains d3buja_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 3bujA00 A:1-397 Cytochrome p450                                                                                                                                                                                                                                                                                                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhh.eee.hhh.eee.hhhhhhhhhh...eehhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...eeehhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh....eeeeee...eee..eee....eeeeehhhhh.........................hhhhh..hhhhhhhhhhhhhhhhhh....ee.....................eee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3buj A   1 VTAFDPTDADVRRDPYPSYHWLLRHDPVHRGAHRVWYVSRFADVRAVLGDERFARTGIRRFWTDLVGPGLLAEIVGDIILFQDEPDHGRLRGVVGPAFSPSALRRLEPVIAGTVDDLLRPALARGAMDVVDELAYPLALRAVLGLLGLPAADWGAVGRWSRDVGRTLDRGASAEDMRRGHAAIAEFADYVERALARRRREGGEDLLALMLDAHDRGLMSRNEIVSTVVTFIFTGHETVASQVGNAVLSLLAHPDQLDLLRRRPDLLAQAVEECLRYDPSVQSNTRQLDVDVELRGRRLRRDDVVVVLAGAANRDPRRYDRPDDFDIERDPVPSMSFGAGMRYCLGSYLARTQLRAAVAALARLPGLRLGCASDALAYQPRTMFRGLASLPIAFTPGG 397
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3BUJ)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q8KND6_MICEC | Q8KND6)
molecular function
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016705    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen    Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:84 - Pro A:85   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3buj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8KND6_MICEC | Q8KND6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8KND6_MICEC | Q8KND6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3BUJ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3BUJ)