|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)| Asymmetric Unit (3, 6) Biological Unit 1 (3, 12) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3BS3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3BS3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3BS3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3BS3) |
Exons (0, 0)| (no "Exon" information available for 3BS3) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:62 aligned with Q5LGD2_BACFN | Q5LGD2 from UniProtKB/TrEMBL Length:73 Alignment length:62 16 26 36 46 56 66 Q5LGD2_BACFN 7 MMLNRIKVVLAEKQRTNRWLAEQMGKSENTISRWCSNKSQPSLDMLVKVAELLNVDPRQLIN 68 SCOP domains -------------------------------------------------------------- SCOP domains CATH domains --3bs3A00 A:9-68 lambda repressor-like DNA-binding domains CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 3bs3 A 7 mmLNRIKVVLAEKQRTNRWLAEQmGKSENTISRWCSNKSQPSLDmLVKVAELLNVDPRQLIN 68 || 16 26 | 36 46 | 56 66 || 30-MSE 51-MSE 7-MSE 8-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3BS3) |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3BS3) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (Q5LGD2_BACFN | Q5LGD2)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|