Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SUGAR TRANSPORTER FROM CLOSTRIDIUM PHYTOFERMENTANS
 
Authors :  V. N. Malashkevich, Y. Patskovsky, R. Toro, A. J. Meyers, S. Wasserman, J. M. Sauder, S. K. Burley, S. C. Almo, New York Sgx Research Center Structural Genomics (Nysgxrc)
Date :  21 Dec 07  (Deposition) - 05 Feb 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Structural Genomics, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Sugar Transporter, Psi-2, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. N. Malashkevich, Y. Patskovsky, R. Toro, A. J. Meyers, S. Wasserman J. M. Sauder, S. K. Burley, S. C. Almo
Crystal Structure Of Sugar Transporter From Clostridium Phytofermentans.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PERIPLASMIC BINDING PROTEIN/LACI TRANSCRIPTIONAL REGULATOR
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: BC-PSGX3(BC)
    Expression System Strain: BL21(DE3)CODON+RIL
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 32-309
    Gene: CPHYDRAFT_2568
    Organism Scientific: CLOSTRIDIUM PHYTOFERMENTANS
    Organism Taxid: 357809
    Strain: ISDG

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3BRS)

(-) Sites  (0, 0)

(no "Site" information available for 3BRS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3BRS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3BRS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3BRS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3BRS)

(-) Exons   (0, 0)

(no "Exon" information available for 3BRS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:271
 aligned with A9KIC5_LACP7 | A9KIC5 from UniProtKB/TrEMBL  Length:325

    Alignment length:276
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302      
         A9KIC5_LACP7    33 QYYMICIPKVLDDSSDFWSVLVEGAQMAAKEYEIKLEFMAPEKEEDYLVQNELIEEAIKRKPDVILLAAADYEKTYDAAKEIKDAGIKLIVIDSGMKQDIADITVATDNIQAGIRIGAVTKNLVRKSGKIGVISFVKNSKTAMDREEGLKIGLSDDSNKIEAIYYCDSNYDKAYDGTVELLTKYPDISVMVGLNQYSATGAARAIKDMSLEAKVKLVCIDSSMEQIQYLEEGIFEAMVVQKPFNIGYLGVEKALKLLKKEYVPKQLDSGCALITKD 308
               SCOP domains d3brsa_ A: automated matches                                                                                                                                                                                                                                                         SCOP domains
               CATH domains 3brsA01 A:5-112,A:245-273  [code=3.40.50.2300, no name defined]                                             3brsA02 A:113-244,A:274-280  [code=3.40.50.2300, no name defined]                                                                   3brsA01 A:5-112,A:245-273    3brsA02 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee.......hhhhhhhhhhhhhhhhhhh.eeee.......hhhhhhhhhhhhhhh...eeee.......hhhhhhhhhhhh.eeeee..........eeee.hhhhhhhhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh......eeeeee.....-----.....eeee.hhhhhhhhhhhhhhhhhhh.....eee...eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3brs A   5 QYYMICIPKVLDDSSDFWSVLVEGAQMAAKEYEIKLEFMAPEKEEDYLVQNELIEEAIKRKPDVILLAAADYEKTYDAAKEIKDAGIKLIVIDSGMKQDIADITVATDNIQAGIRIGAVTKNLVRKSGKIGVISFVKNSKTAMDREEGLKIGLSDDSNKIEAIYYCDSNYDKAYDGTVELLTKYPDISVMVGLNQYSATGAARAIKDMSLEAKVKLVCIDSSMEQ-----EGIFEAMVVQKPFNIGYLGVEKALKLLKKEYVPKQLDSGCALITKD 280
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224    |    -|      244       254       264       274      
                                                                                                                                                                                                                                                          229   235                                             


Chain B from PDB  Type:PROTEIN  Length:271
 aligned with A9KIC5_LACP7 | A9KIC5 from UniProtKB/TrEMBL  Length:325

    Alignment length:276
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302      
         A9KIC5_LACP7    33 QYYMICIPKVLDDSSDFWSVLVEGAQMAAKEYEIKLEFMAPEKEEDYLVQNELIEEAIKRKPDVILLAAADYEKTYDAAKEIKDAGIKLIVIDSGMKQDIADITVATDNIQAGIRIGAVTKNLVRKSGKIGVISFVKNSKTAMDREEGLKIGLSDDSNKIEAIYYCDSNYDKAYDGTVELLTKYPDISVMVGLNQYSATGAARAIKDMSLEAKVKLVCIDSSMEQIQYLEEGIFEAMVVQKPFNIGYLGVEKALKLLKKEYVPKQLDSGCALITKD 308
               SCOP domains d3brsb_ B: automated matches                                                                                                                                                                                                                                                         SCOP domains
               CATH domains 3brsB01 B:5-112,B:245-273  [code=3.40.50.2300, no name defined]                                             3brsB02 B:113-244,B:274-280  [code=3.40.50.2300, no name defined]                                                                   3brsB01 B:5-112,B:245-273    3brsB02 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee.......hhhhhhhhhhhhhhhhhhh.eeee.......hhhhhhhhhhhhhhh...eeee.......hhhhhhhhhhhh.eeeee..........eeee.hhhhhhhhhhhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh......eeeeee....-----......eeeeehhhhhhhhhhhhhhhhhh......eee..eeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3brs B   5 QYYMICIPKVLDDSSDFWSVLVEGAQMAAKEYEIKLEFMAPEKEEDYLVQNELIEEAIKRKPDVILLAAADYEKTYDAAKEIKDAGIKLIVIDSGMKQDIADITVATDNIQAGIRIGAVTKNLVRKSGKIGVISFVKNSKTAMDREEGLKIGLSDDSNKIEAIYYCDSNYDKAYDGTVELLTKYPDISVMVGLNQYSATGAARAIKDMSLEAKVKLVCIDSSME-----EEGIFEAMVVQKPFNIGYLGVEKALKLLKKEYVPKQLDSGCALITKD 280
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224   |   234       244       254       264       274      
                                                                                                                                                                                                                                                         228   234
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3BRS)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3BRS)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3brs)
 
  Sites
(no "Sites" information available for 3brs)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3brs)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3brs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9KIC5_LACP7 | A9KIC5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A9KIC5_LACP7 | A9KIC5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3BRS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3BRS)