Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RIBOFLAVIN KINASE FROM TRYPANOSOMA BRUCEI
 
Authors :  E. A. Merritt, M. Holmes, Structural Genomics Of Pathogenic Proto Consortium (Sgpp)
Date :  14 Dec 07  (Deposition) - 08 Jan 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A (1x),B (1x)
Keywords :  Apo Structure, Structural Genomics, Structural Genomics Of Pathogenic Protozoa Consortium, Sgpp, Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. A. Merritt, M. Holmes
Riboflavin Kinase From Trypanosoma Brucei.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - RIBOFLAVIN KINASE, PUTATIVE
    Chains: A, B
    EC Number: 2.7.1.26
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET3A
    Expression System Strain: BL21(DE3)PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TB09.211.3420
    Organism Scientific: TRYPANOSOMA BRUCEI
    Organism Taxid: 5691
    Strain: 927/4 GUTAT10.1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B
Biological Unit 3 (1x): A (1x)B (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3BNW)

(-) Sites  (0, 0)

(no "Site" information available for 3BNW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3BNW)

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Gly A:70 -Pro A:71
2Ile A:164 -Pro A:165
3Phe B:29 -Pro B:30
4Gly B:70 -Pro B:71
5Ile B:164 -Pro B:165

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3BNW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3BNW)

(-) Exons   (0, 0)

(no "Exon" information available for 3BNW)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:160
 aligned with Q38DG4_TRYB2 | Q38DG4 from UniProtKB/TrEMBL  Length:173

    Alignment length:172
                             1                                                                                                                                                                          
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169  
         Q38DG4_TRYB2     - -MRQTGSFQPFFLRGKVVHGKGRGGSQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGFNMQFDEKTLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP 171
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3bnwA00 A:0-171 Rib      oflavin kinase-like                                                                                                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeeeeee.------........ee..hhhhhhhhhhhh.eeeeeeeeeeee..eeeeeeeeeeeeeeee..------..eeeeee...........eeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........eeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3bnw A   0 HMRQTGSFQPFFLRGKVVH------SQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGFN------TLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP 171
                                     9        |-     |  29        39        49        59        69        79 |      89        99       109       119       129       139       149       159       169  
                                             18     25                                                      81     88                                                                                   


Chain B from PDB  Type:PROTEIN  Length:157
 aligned with Q38DG4_TRYB2 | Q38DG4 from UniProtKB/TrEMBL  Length:173

    Alignment length:167
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       
         Q38DG4_TRYB2     5 GSFQPFFLRGKVVHGKGRGGSQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGFNMQFDEKTLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP 171
               SCOP domains d3bnwb_ B: auto     mated matches                                                                                                                                       SCOP domains
               CATH domains 3bnwB00 B:5-171      Riboflavin kinase-like                                                                                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeee..-----........ee..hhhhhhhhhhhh.eeeeeeeeeeee..eeeeeeeeeeeeeeee.-----....eeeeee...........eeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3bnw B   5 GSFQPFFLRGKVVHG-----SQLGFPTANIGLDKDVMECLQPYKNLVVYGWGTVSQVPGKERESFGPYPFAASIGF-----EKTLTVEPYFLHEFGWDFYGAVVKIIVLGEIRSMGSFHSLQALVDTIKSDVQFTRDMLQKPQLQEFSRHSLFESPSSTIPYFEDLP 171
                                    14    |    -|       34        44        54        64        74     |   - |      94       104       114       124       134       144       154       164       
                                         19    25                                                     80    86
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3BNW)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q38DG4_TRYB2 | Q38DG4)
molecular function
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0008531    riboflavin kinase activity    Catalysis of the reaction: ATP + riboflavin = ADP + FMN + 2 H(+).
biological process
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0009231    riboflavin biosynthetic process    The chemical reactions and pathways resulting in the formation of riboflavin (vitamin B2), the precursor for the coenzymes flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3bnw)
 
  Sites
(no "Sites" information available for 3bnw)
 
  Cis Peptide Bonds
    Gly A:70 - Pro A:71   [ RasMol ]  
    Gly B:70 - Pro B:71   [ RasMol ]  
    Ile A:164 - Pro A:165   [ RasMol ]  
    Ile B:164 - Pro B:165   [ RasMol ]  
    Phe B:29 - Pro B:30   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3bnw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q38DG4_TRYB2 | Q38DG4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.26
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q38DG4_TRYB2 | Q38DG4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3BNW)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3BNW)