|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 9)| Asymmetric Unit (5, 9) Biological Unit 1 (5, 18) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3BLN) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3BLN) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3BLN) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3BLN) |
Exons (0, 0)| (no "Exon" information available for 3BLN) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:142 aligned with Q72YY9_BACC1 | Q72YY9 from UniProtKB/TrEMBL Length:142 Alignment length:142 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 Q72YY9_BACC1 - -MKNVTKASIDDLDSIVHIDIDVIGNDSRRNYIKHSIDEGRCVIVKEDNSISGFLTYDTNFFDCTFLSLIIVSPTKRRRGYASSLLSYMLSHSPTQKIFSSTNESNESMQKVFNANGFIRSGIVENLDEGDPEIIFYTKKLR 141 SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 3blnA00 A:0-141 [code=3.40.630.30, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3bln A 0 GmKNVTKASIDDLDSIVHIDIDVIGNDSRRNYIKHSIDEGRCVIVKEDNSISGFLTYDTNFFDCTFLSLIIVSPTKRRRGYASSLLSYmLSHSPTQKIFSSTNESNESmQKVFNANGFIRSGIVENLDEGDPEIIFYTKKLR 141 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 | 88-MSE 108-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3BLN) |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3BLN) |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (Q72YY9_BACC1 | Q72YY9)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|