3BJU - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF TETRAMERIC FORM OF HUMAN LYSYL-TRNA SYNTHETASE

Authors :   M. Guo, X. L. Yang, P. Schimmel

Date :   04 Dec 07 (Deposition) - 05 Feb 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.31

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: A,B  (1x)
Biol. Unit 3: C,D  (1x)

Keywords :   Trna Synthetase, Lysyl-Trna, Aminoacyl-Trna Synthetase, Atp- Binding, Cytoplasm, Ligase, Nucleotide-Binding, Phosphoprotein, Polymorphism, Protein Biosynthesis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Guo, M. Ignatov, K. Musier-Forsyth, P. Schimmel, X. L. Yang
Crystal Structure Of Tetrameric Form Of Human Lysyl-Trna Synthetase: Implications For Multisynthetase Complex Formation
Proc. Natl. Acad. Sci. Usa V. 105 2331 2008
PubMed-ID: 18272479 | Reference-DOI: 10.1073/PNAS.0712072105
(for further references see the PDB file header)

Molecule 1 - LYSYL-TRNA SYNTHETASE
	Chains	:	A, B, C, D
	EC Number	:	6.1.1.6
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET20B
	Expression System Strain	:	BL21(DE3) CODON PLUS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 70-579
	Gene	:	KARS, KIAA0070
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	LYSINE--TRNA LIGASE, LYSRS

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:	A	B
Biological Unit 3 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 20)

No.	Name	Count	Type	Full Name
1	ATP	4	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE
2	CA	12	Ligand/Ion	CALCIUM ION
3	LYS	4	Mod. Amino Acid	LYSINE

Biological Unit 1 (2, 8)

No.	Name	Count	Type	Full Name
1	ATP	4	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE
2	CA	-1	Ligand/Ion	CALCIUM ION
3	LYS	4	Mod. Amino Acid	LYSINE

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	ATP	2	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE
2	CA	-1	Ligand/Ion	CALCIUM ION
3	LYS	2	Mod. Amino Acid	LYSINE

Biological Unit 3 (2, 4)

No.	Name	Count	Type	Full Name
1	ATP	2	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE
2	CA	-1	Ligand/Ion	CALCIUM ION
3	LYS	2	Mod. Amino Acid	LYSINE

Asymmetric Unit (20, 20)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLU A:487 , GLU A:494 , ATP A:603 , CA A:608 , HOH A:786 , HOH A:794	BINDING SITE FOR RESIDUE CA A 606
02	AC3	SOFTWARE	ATP A:603 , HOH A:653 , HOH A:714	BINDING SITE FOR RESIDUE CA A 607
03	AC4	SOFTWARE	GLU A:494 , ATP A:603 , CA A:606 , HOH A:674 , HOH A:786 , HOH A:824	BINDING SITE FOR RESIDUE CA A 608
04	AC6	SOFTWARE	GLU B:487 , GLU B:494 , ATP B:603 , CA B:608 , HOH B:812 , HOH B:866	BINDING SITE FOR RESIDUE CA B 606
05	AC7	SOFTWARE	ATP B:603 , HOH B:827 , HOH B:903 , HOH B:914	BINDING SITE FOR RESIDUE CA B 607
06	AC9	SOFTWARE	GLU B:494 , ATP B:603 , CA B:606 , HOH B:812 , HOH B:840 , HOH B:843	BINDING SITE FOR RESIDUE CA B 608
07	AD1	SOFTWARE	GLU C:487 , GLU C:494 , ATP C:603 , CA C:608	BINDING SITE FOR RESIDUE CA C 606
08	AD2	SOFTWARE	ATP C:603 , HOH C:704 , HOH C:856	BINDING SITE FOR RESIDUE CA C 607
09	AD3	SOFTWARE	GLU C:494 , ATP C:603 , CA C:606 , HOH C:670 , HOH C:838	BINDING SITE FOR RESIDUE CA C 608
10	AD4	SOFTWARE	ATP D:603 , HOH D:752	BINDING SITE FOR RESIDUE CA D 607
11	BC1	SOFTWARE	GLU D:487 , GLU D:494 , ATP D:603 , CA D:608	BINDING SITE FOR RESIDUE CA D 606
12	BC3	SOFTWARE	GLU D:494 , ATP D:603 , CA D:606 , HOH D:699 , HOH D:759 , HOH D:770	BINDING SITE FOR RESIDUE CA D 608
13	BC4	SOFTWARE	GLY A:277 , ALA A:278 , ALA A:299 , GLU A:301 , ARG A:323 , GLU A:339 , TYR A:341 , ASN A:497 , TYR A:499 , GLU A:501 , GLY A:546 , ATP A:603 , HOH A:698	BINDING SITE FOR RESIDUE LYS A 601
14	BC5	SOFTWARE	ARG A:323 , GLU A:325 , THR A:330 , HIS A:331 , ASN A:332 , PHE A:335 , GLU A:494 , ILE A:495 , ASN A:497 , GLY A:550 , ARG A:553 , ILE A:564 , LYS A:601 , CA A:606 , CA A:607 , CA A:608 , HOH A:609 , HOH A:653 , HOH A:674 , HOH A:776 , HOH A:786 , HOH A:824 , HOH A:825	BINDING SITE FOR RESIDUE ATP A 603
15	BC6	SOFTWARE	GLY B:277 , ALA B:278 , ALA B:299 , GLU B:301 , ARG B:323 , GLU B:339 , TYR B:341 , ASN B:497 , TYR B:499 , GLU B:501 , GLY B:546 , ATP B:603 , HOH B:790	BINDING SITE FOR RESIDUE LYS B 601
16	BC7	SOFTWARE	ARG B:323 , GLU B:325 , THR B:330 , HIS B:331 , ASN B:332 , PHE B:335 , GLU B:494 , ILE B:495 , ASN B:497 , GLY B:550 , ARG B:553 , LYS B:601 , CA B:606 , CA B:607 , CA B:608 , HOH B:678 , HOH B:740 , HOH B:812 , HOH B:827 , HOH B:843 , HOH B:875 , HOH B:914	BINDING SITE FOR RESIDUE ATP B 603
17	BC8	SOFTWARE	GLY C:277 , ALA C:278 , ALA C:299 , GLU C:301 , ARG C:323 , GLU C:339 , TYR C:341 , ASN C:497 , TYR C:499 , GLU C:501 , GLY C:546 , ATP C:603 , HOH C:714	BINDING SITE FOR RESIDUE LYS C 601
18	BC9	SOFTWARE	ARG C:323 , GLU C:325 , THR C:330 , HIS C:331 , ASN C:332 , PHE C:335 , GLU C:494 , ILE C:495 , ASN C:497 , GLY C:550 , ARG C:553 , ILE C:564 , LYS C:601 , CA C:606 , CA C:607 , CA C:608 , HOH C:609 , HOH C:670 , HOH C:678 , HOH C:797 , HOH C:856	BINDING SITE FOR RESIDUE ATP C 603
19	CC1	SOFTWARE	GLY D:277 , ALA D:278 , ALA D:299 , GLU D:301 , GLU D:339 , TYR D:341 , ASN D:497 , TYR D:499 , GLU D:501 , GLY D:546 , GLY D:548 , ATP D:603 , HOH D:689	BINDING SITE FOR RESIDUE LYS D 601
20	CC2	SOFTWARE	ARG D:323 , GLU D:325 , THR D:330 , HIS D:331 , ASN D:332 , PHE D:335 , GLU D:494 , ILE D:495 , ASN D:497 , GLY D:550 , ARG D:553 , LYS D:601 , CA D:606 , CA D:607 , CA D:608 , HOH D:610 , HOH D:687 , HOH D:699 , HOH D:752 , HOH D:759 , HOH D:797	BINDING SITE FOR RESIDUE ATP D 603

(no "SS Bond" information available for 3BJU)

Asymmetric Unit

No.	Residues
1	Pro A:389	-	Pro A:390
2	Pro A:436	-	Pro A:437
3	Pro B:389	-	Pro B:390
4	Pro B:436	-	Pro B:437
5	Pro C:389	-	Pro C:390
6	Pro C:436	-	Pro C:437
7	Pro D:389	-	Pro D:390
8	Pro D:436	-	Pro D:437

Asymmetric Unit (5, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_064911	L	105	H	SYK_HUMAN	Disease (CMTRIB)	267607194	A/B/C/D	L	105	H
2	UniProt	VAR_070233	Y	145	H	SYK_HUMAN	Disease (DFNB89)	397514745	A/B/C/D	Y	145	H
3	UniProt	VAR_052640	G	179	A	SYK_HUMAN	Polymorphism	11557665	A/B/C/D	G	179	A
4	UniProt	VAR_064912	I	274	M	SYK_HUMAN	Disease (CMTRIB)	146955132	A/B/C/D	I	274	M
5	UniProt	VAR_070234	D	349	N	SYK_HUMAN	Disease (DFNB89)	397514746	A/B/C/D	D	349	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (5, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_064911	L	105	H	SYK_HUMAN	Disease (CMTRIB)	267607194	A/B/C/D	L	105	H
2	UniProt	VAR_070233	Y	145	H	SYK_HUMAN	Disease (DFNB89)	397514745	A/B/C/D	Y	145	H
3	UniProt	VAR_052640	G	179	A	SYK_HUMAN	Polymorphism	11557665	A/B/C/D	G	179	A
4	UniProt	VAR_064912	I	274	M	SYK_HUMAN	Disease (CMTRIB)	146955132	A/B/C/D	I	274	M
5	UniProt	VAR_070234	D	349	N	SYK_HUMAN	Disease (DFNB89)	397514746	A/B/C/D	D	349	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (5, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_064911	L	105	H	SYK_HUMAN	Disease (CMTRIB)	267607194	A/B	L	105	H
2	UniProt	VAR_070233	Y	145	H	SYK_HUMAN	Disease (DFNB89)	397514745	A/B	Y	145	H
3	UniProt	VAR_052640	G	179	A	SYK_HUMAN	Polymorphism	11557665	A/B	G	179	A
4	UniProt	VAR_064912	I	274	M	SYK_HUMAN	Disease (CMTRIB)	146955132	A/B	I	274	M
5	UniProt	VAR_070234	D	349	N	SYK_HUMAN	Disease (DFNB89)	397514746	A/B	D	349	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (5, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_064911	L	105	H	SYK_HUMAN	Disease (CMTRIB)	267607194	C/D	L	105	H
2	UniProt	VAR_070233	Y	145	H	SYK_HUMAN	Disease (DFNB89)	397514745	C/D	Y	145	H
3	UniProt	VAR_052640	G	179	A	SYK_HUMAN	Polymorphism	11557665	C/D	G	179	A
4	UniProt	VAR_064912	I	274	M	SYK_HUMAN	Disease (CMTRIB)	146955132	C/D	I	274	M
5	UniProt	VAR_070234	D	349	N	SYK_HUMAN	Disease (DFNB89)	397514746	C/D	D	349	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3BJU)

Asymmetric Unit (13, 52)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000302445	1a	ENSE00001844980	chr16:75681577-75681476	102	SYK_HUMAN	1-21	21	0	-	-
1.3	ENST00000302445	3	ENSE00001143107	chr16:75675621-75675462	160	SYK_HUMAN	21-74	54	4	A:70-74 B:72-74 C:72-74 D:71-74	5 3 3 4
1.4b	ENST00000302445	4b	ENSE00001107190	chr16:75674247-75674082	166	SYK_HUMAN	75-130	56	4	A:75-130 B:75-130 C:75-130 D:75-130	56 56 56 56
1.5	ENST00000302445	5	ENSE00001107188	chr16:75670445-75670352	94	SYK_HUMAN	130-161	32	4	A:130-161 B:130-161 C:130-161 D:130-161	32 32 32 32
1.6a	ENST00000302445	6a	ENSE00001107162	chr16:75669996-75669810	187	SYK_HUMAN	161-223	63	4	A:161-223 (gaps) B:161-223 (gaps) C:161-223 (gaps) D:161-223 (gaps)	63 63 63 63
1.7	ENST00000302445	7	ENSE00001107185	chr16:75669703-75669578	126	SYK_HUMAN	224-265	42	4	A:224-265 B:224-265 C:224-265 D:224-265	42 42 42 42
1.8	ENST00000302445	8	ENSE00001107173	chr16:75668190-75668071	120	SYK_HUMAN	266-305	40	4	A:266-305 B:266-305 C:266-305 D:266-305	40 40 40 40
1.9	ENST00000302445	9	ENSE00001107193	chr16:75665753-75665591	163	SYK_HUMAN	306-360	55	4	A:306-360 B:306-360 C:306-360 D:306-360	55 55 55 55
1.10b	ENST00000302445	10b	ENSE00001107182	chr16:75665487-75665314	174	SYK_HUMAN	360-418	59	4	A:360-418 B:360-418 C:360-418 D:360-418	59 59 59 59
1.11	ENST00000302445	11	ENSE00001107180	chr16:75665151-75665066	86	SYK_HUMAN	418-446	29	4	A:418-446 B:418-446 C:418-446 D:418-446	29 29 29 29
1.12	ENST00000302445	12	ENSE00001107178	chr16:75664406-75664321	86	SYK_HUMAN	447-475	29	4	A:447-475 B:447-475 C:447-475 D:447-475	29 29 29 29
1.13	ENST00000302445	13	ENSE00001107196	chr16:75663439-75663313	127	SYK_HUMAN	475-517	43	4	A:475-517 B:475-517 C:475-517 D:475-517	43 43 43 43
1.14	ENST00000302445	14	ENSE00001107165	chr16:75662610-75662467	144	SYK_HUMAN	518-565	48	4	A:518-565 B:518-565 C:518-565 D:518-565	48 48 48 48
1.15b	ENST00000302445	15b	ENSE00001900311	chr16:75661891-75661622	270	SYK_HUMAN	566-597	32	4	A:566-601 (gaps) B:566-601 C:566-601 D:566-601	37 10 11 11

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:504
 aligned with SYK_HUMAN | Q15046 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:510
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579
            SYK_HUMAN    70 SVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKK 579
               SCOP domains d3bjua1 A:70-221 automated matches                                                                                                                      d3bjua2 A:222-576 automated matches                                                                                                                                                                                                                                                                                                                                  - SCOP domains
               CATH domains ---3bjuA01 A:73-220 Nucleic acid-binding proteins                                                                                                      3bjuA02 A:221-573 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                                                                                                            ---  - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhh............eeeeeeeeeeee....eeeeeeee..eeeeeeee.hhh.hhhhhhhhhhhh....eeeeeeeeee.....eeeeeeeeeeee........----..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.....ee...........eeee....eeeee...hhhhhhhhhhh...eeeeeeeee...........eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhh..eeee.........eeee.....eeeehhhhhhhhhh....hhhhh.hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh...eeee..hhhhh..............eeeeee..eeeeeeee...hhhhhhhhhhhhhhhhhhh.......hhhhhhhhh.....eeeeeeehhhhhhhhh...hhhhh.........--. Sec.struct. author
                 SAPs(SNPs) -----------------------------------H---------------------------------------H---------------------------------A----------------------------------------------------------------------------------------------M--------------------------------------------------------------------------N-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.3  Exon 1.4b  PDB: A:75-130 UniProt: 75-130                ------------------------------Exon 1.6a  PDB: A:161-223 (gaps) UniProt: 161-223              Exon 1.7  PDB: A:224-265 UniProt: 224-265 Exon 1.8  PDB: A:266-305                ------------------------------------------------------Exon 1.10b  PDB: A:360-418 UniProt: 360-418                ----------------------------Exon 1.12  PDB: A:447-475    ------------------------------------------Exon 1.14  PDB: A:518-565 UniProt: 518-565      Exon 1.15b     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.5  PDB: A:130-161        ------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: A:306-360 UniProt: 306-360              ---------------------------------------------------------Exon 1.11  PDB: A:418-446    ----------------------------Exon 1.13  PDB: A:475-517 UniProt: 475-517 -------------------------------------------------------------- Transcript 1 (2)
                 3bju A  70 SVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPH----LKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE--K 601
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209     |   -|      229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569      |601
                                                                                                                                                                           215  220                                                                                                                                                                                                                                                                                                                                                                 576  |
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       601

Chain B from PDB  Type:PROTEIN  Length:496
 aligned with SYK_HUMAN | Q15046 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:504
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571    
            SYK_HUMAN    72 DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKP 575
               SCOP domains d3bjub1 B:72-214 automated matches                                                                                                             --------d3bjub2 B:223-574 automated matches                                                                                                                                                                                                                                                                                                                             - SCOP domains
               CATH domains -3bjuB01 B:73-214 Nucleic acid-binding proteins                                                                                                --------3bjuB02 B:223-573 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                                                                                                          -- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh.............hhhhhhhhh.............eeeeeeeeeeee....eeeeeeee..eeeeeeee.....hhhhhhhhhhhh....eeeeeeeeee.....eeeeeeeeeeee.......--------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.....ee...........eeee....eeeee...hhhhhhhhhhh...eeeeeeeee...........eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhh...eeee.........eeee.....eeeehhhhhhhhhh....hhhhh.hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh...eeee..hhhhh..............eeeeee..eeeeeeee...hhhhhhhhhhhhhhhhhh........hhhhhhhhh.....eeeeeeehhhhhhhhh...hhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------H---------------------------------------H---------------------------------A----------------------------------------------------------------------------------------------M--------------------------------------------------------------------------N---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.3Exon 1.4b  PDB: B:75-130 UniProt: 75-130                ------------------------------Exon 1.6a  PDB: B:161-223 (gaps) UniProt: 161-223              Exon 1.7  PDB: B:224-265 UniProt: 224-265 Exon 1.8  PDB: B:266-305                ------------------------------------------------------Exon 1.10b  PDB: B:360-418 UniProt: 360-418                ----------------------------Exon 1.12  PDB: B:447-475    ------------------------------------------Exon 1.14  PDB: B:518-565 UniProt: 518-565      Exon 1.15b Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.5  PDB: B:130-161        ------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: B:306-360 UniProt: 306-360              ---------------------------------------------------------Exon 1.11  PDB: B:418-446    ----------------------------Exon 1.13  PDB: B:475-517 UniProt: 475-517 ---------------------------------------------------------- Transcript 1 (2)
                 3bju B  72 DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLP--------KETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKK 601
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211  |      - |     231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571  ||
                                                                                                                                                                        214      223                                                                                                                                                                                                                                                                                                                                                            574|
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 601

Chain C from PDB  Type:PROTEIN  Length:502
 aligned with SYK_HUMAN | Q15046 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:505
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571     
            SYK_HUMAN    72 DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE 576
               SCOP domains d3bjuc1 C:72-221 automated matches                                                                                                                    d3bjuc2 C:222-575 automated matches                                                                                                                                                                                                                                                                                                                               - SCOP domains
               CATH domains -3bjuC01 C:73-220 Nucleic acid-binding proteins                                                                                                      3bjuC02 C:221-573 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                                                                                                            --- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhh............eeeeeeeeeeee....eeeeeeee..eeeeeeee.....hhhhhhhhhh......eeeeeeeeee.....eeeeeeeeeeee........---...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.....ee...........eeee....eeeee...hhhhhhhhhhh...eeeeeeeee...........eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhh..eeee.........eeee.....eeeehhhhhhhhhh....hhhhh.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh...eeee..hhhhh..............eeeeee..eeeeeeee...hhhhhhhhhhhhhhhhhh........hhhhhhhhh.....eeeeeeehhhhhhhhh...hhhhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------H---------------------------------------H---------------------------------A----------------------------------------------------------------------------------------------M--------------------------------------------------------------------------N----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.3Exon 1.4b  PDB: C:75-130 UniProt: 75-130                ------------------------------Exon 1.6a  PDB: C:161-223 (gaps) UniProt: 161-223              Exon 1.7  PDB: C:224-265 UniProt: 224-265 Exon 1.8  PDB: C:266-305                ------------------------------------------------------Exon 1.10b  PDB: C:360-418 UniProt: 360-418                ----------------------------Exon 1.12  PDB: C:447-475    ------------------------------------------Exon 1.14  PDB: C:518-565 UniProt: 518-565      Exon 1.15b  Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.5  PDB: C:130-161        ------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: C:306-360 UniProt: 306-360              ---------------------------------------------------------Exon 1.11  PDB: C:418-446    ----------------------------Exon 1.13  PDB: C:475-517 UniProt: 475-517 ----------------------------------------------------------- Transcript 1 (2)
                 3bju C  72 DPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPH---GLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPK 601
                                    81        91       101       111       121       131       141       151       161       171       181       191       201       211   |   221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571   ||
                                                                                                                                                                         215 219                                                                                                                                                                                                                                                                                                                                                                 575|
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  601

Chain D from PDB  Type:PROTEIN  Length:500
 aligned with SYK_HUMAN | Q15046 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:506
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570      
            SYK_HUMAN    71 VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE 576
               SCOP domains d3bjud1 D:71-221 automated matches                                                                                                                     d3bjud2 D:222-575 automated matches                                                                                                                                                                                                                                                                                                                               - SCOP domains
               CATH domains --3bjuD01 D:73-214 Nucleic acid-binding proteins                                                                                                ------3bjuD02 D:221-573 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                                                                                                            --- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh.............hhhhhhhhh.............eeeeeeeeeeee....eeeeeeee..eeeeeeee.....hhhhhhhhhhhh....eeeeeeeeee.....eeeeeeeeeeee.......------.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.....ee...........eeee....eeeee...hhhhhhhhhhh...eeeeeeeee...........eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhh..eeee.........eeee.....eeeehhhhhhhhhh....hhhhh.hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh...eeee..hhhhh..............eeeeee..eeeeeeee...hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh..eeeeeeehhhhhhhhh...hhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------H---------------------------------------H---------------------------------A----------------------------------------------------------------------------------------------M--------------------------------------------------------------------------N----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.3 Exon 1.4b  PDB: D:75-130 UniProt: 75-130                ------------------------------Exon 1.6a  PDB: D:161-223 (gaps) UniProt: 161-223              Exon 1.7  PDB: D:224-265 UniProt: 224-265 Exon 1.8  PDB: D:266-305                ------------------------------------------------------Exon 1.10b  PDB: D:360-418 UniProt: 360-418                ----------------------------Exon 1.12  PDB: D:447-475    ------------------------------------------Exon 1.14  PDB: D:518-565 UniProt: 518-565      Exon 1.15b  Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------Exon 1.5  PDB: D:130-161        ------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: D:306-360 UniProt: 306-360              ---------------------------------------------------------Exon 1.11  PDB: D:418-446    ----------------------------Exon 1.13  PDB: D:475-517 UniProt: 475-517 ----------------------------------------------------------- Transcript 1 (2)
                 3bju D  71 VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLP------KDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPK 601
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210   |     -|      230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570    ||
                                                                                                                                                                         214    221                                                                                                                                                                                                                                                                                                                                                               575|
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   601

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: OB-fold (1179)

Superfamily: Nucleic acid-binding proteins (590)

Family: automated matches (46)

Protein domain: automated matches (46)

Human (Homo sapiens) [TaxId: 9606] (6)

1a	d3bjua1	A:70-221
1b	d3bjub1	B:72-214
1c	d3bjuc1	C:72-221
1d	d3bjud1	D:71-221

Class: Alpha and beta proteins (a+b) (23004)

Fold: Class II aaRS and biotin synthetases (165)

Superfamily: Class II aaRS and biotin synthetases (165)

Family: automated matches (17)

Protein domain: automated matches (17)

Human (Homo sapiens) [TaxId: 9606] (4)

2a	d3bjua2	A:222-576
2b	d3bjub2	B:223-574
2c	d3bjuc2	C:222-575
2d	d3bjud2	D:222-575

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: BirA Bifunctional Protein; domain 2 (111)

Homologous Superfamily: Bira Bifunctional Protein; Domain 2 (111)

Human (Homo sapiens) (11)

1a	3bjuB02	B:223-573
1b	3bjuA02	A:221-573
1c	3bjuC02	C:221-573
1d	3bjuD02	D:221-573

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: OB fold (Dihydrolipoamide Acetyltransferase, E2P) (1040)

Homologous Superfamily: Nucleic acid-binding proteins (483)

Human (Homo sapiens) (27)

2a	3bjuB01	B:73-214
2b	3bjuD01	D:73-214
2c	3bjuA01	A:73-220
2d	3bjuC01	C:73-220

(no "Pfam Domain" information available for 3BJU)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (SYK_HUMAN | Q15046)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016597	amino acid binding	Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
	GO:0004812	aminoacyl-tRNA ligase activity	Catalysis of the formation of aminoacyl-tRNA from ATP, amino acid, and tRNA with the release of diphosphate and AMP.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0004824	lysine-tRNA ligase activity	Catalysis of the reaction: ATP + L-lysine + tRNA(Lys) = AMP + diphosphate + L-lysyl-tRNA(Lys).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
biological process
	GO:0015966	diadenosine tetraphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of diadenosine tetraphosphate, a derivative of the nucleoside adenosine with four phosphate groups attached.
	GO:0006430	lysyl-tRNA aminoacylation	The process of coupling lysine to lysyl-tRNA, catalyzed by lysyl-tRNA synthetase. In tRNA aminoacylation, the amino acid is first activated by linkage to AMP and then transferred to either the 2'- or the 3'-hydroxyl group of the 3'-adenosine residue of the tRNA.
	GO:0006418	tRNA aminoacylation for protein translation	The synthesis of aminoacyl tRNA by the formation of an ester bond between the 3'-hydroxyl group of the most 3' adenosine of the tRNA, to be used in ribosome-mediated polypeptide synthesis.
	GO:0008033	tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	A multienzyme complex found in all multicellular eukaryotes composed of eight proteins with aminoacyl-tRNA synthetase activities (abbreviated as: ArgRS, AspRS, GluProRS, GlnRS, IleRS, LeuRS, LysRS, MetRS where RS is the enzyme, preceded by the amino acid it uses as a substrate) as well as three non-synthetase proteins (p43, p38, and p18) with diverse functions. Several of these subunits are known dimers, so the total polypeptide count in the multisynthetase complex is at least fifteen. All of the enzymes in this assembly catalyze the same reaction, the covalent attachment of an amino acid to either the 2'- or 3'-hydroxyl of the 3'-terminal adenosine of tRNA, but using different substrates.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0015630	microtubule cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of microtubules and associated proteins.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ATP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		LYS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]
		CC1	[ RasMol ]	+environment [ RasMol ]
		CC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Pro A:389 - Pro A:390	[ RasMol ]
		Pro A:436 - Pro A:437	[ RasMol ]
		Pro B:389 - Pro B:390	[ RasMol ]
		Pro B:436 - Pro B:437	[ RasMol ]
		Pro C:389 - Pro C:390	[ RasMol ]
		Pro C:436 - Pro C:437	[ RasMol ]
		Pro D:389 - Pro D:390	[ RasMol ]
		Pro D:436 - Pro D:437	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3bju
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SYK_HUMAN \| Q15046
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	6.1.1.6
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	613641
		Disease Information	:	OMIM
	613916
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SYK_HUMAN \| Q15046
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SYK_HUMAN \| Q15046	:	4dpg 4ycu 4ycw

(no "Related Entries Specified in the PDB File" available for 3BJU)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 20)

Sites (20, 20)

SS Bonds (0, 0)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 20)

PROSITE Motifs (0, 0)

Exons (13, 52)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (26, 26)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File