|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 8) Biological Unit 1 (1, 3) Biological Unit 2 (1, 3) Biological Unit 3 (1, 3) |
Asymmetric Unit (7, 7)
|
(no "SS Bond" information available for 3BBZ) |
(no "Cis Peptide Bond" information available for 3BBZ) |
(no "SAP(SNP)/Variant" information available for 3BBZ) |
(no "PROSITE Motif" information available for 3BBZ) |
(no "Exon" information available for 3BBZ) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:48 aligned with Q9J4L6_MUMPJ | Q9J4L6 from UniProtKB/TrEMBL Length:391 Alignment length:48 353 363 373 383 Q9J4L6_MUMPJ 344 GQKVMITKMITDCVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI 391 SCOP domains ------------------------------------------------ SCOP domains CATH domains ------------------------------------------------ CATH domains Pfam domains ------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------ PROSITE Transcript ------------------------------------------------ Transcript 3bbz A 344 GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI 391 353 363 373 383 Chain B from PDB Type:PROTEIN Length:48 aligned with Q9J4L6_MUMPJ | Q9J4L6 from UniProtKB/TrEMBL Length:391 Alignment length:48 353 363 373 383 Q9J4L6_MUMPJ 344 GQKVMITKMITDCVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI 391 SCOP domains ------------------------------------------------ SCOP domains CATH domains ------------------------------------------------ CATH domains Pfam domains ------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------ PROSITE Transcript ------------------------------------------------ Transcript 3bbz B 344 GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI 391 353 363 373 383
|
(no "SCOP Domain" information available for 3BBZ) |
(no "CATH Domain" information available for 3BBZ) |
(no "Pfam Domain" information available for 3BBZ) |
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3BBZ)
|
|
|
|
|
|
|