|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 8)| Asymmetric Unit (2, 8) Biological Unit 1 (1, 3) Biological Unit 2 (1, 3) Biological Unit 3 (1, 3) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3BBZ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3BBZ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3BBZ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3BBZ) |
Exons (0, 0)| (no "Exon" information available for 3BBZ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:48 aligned with Q9J4L6_MUMPJ | Q9J4L6 from UniProtKB/TrEMBL Length:391 Alignment length:48 353 363 373 383 Q9J4L6_MUMPJ 344 GQKVMITKMITDCVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI 391 SCOP domains ------------------------------------------------ SCOP domains CATH domains ------------------------------------------------ CATH domains Pfam domains ------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------ PROSITE Transcript ------------------------------------------------ Transcript 3bbz A 344 GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI 391 353 363 373 383 Chain B from PDB Type:PROTEIN Length:48 aligned with Q9J4L6_MUMPJ | Q9J4L6 from UniProtKB/TrEMBL Length:391 Alignment length:48 353 363 373 383 Q9J4L6_MUMPJ 344 GQKVMITKMITDCVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI 391 SCOP domains ------------------------------------------------ SCOP domains CATH domains ------------------------------------------------ CATH domains Pfam domains ------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------ PROSITE Transcript ------------------------------------------------ Transcript 3bbz B 344 GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI 391 353 363 373 383
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3BBZ) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3BBZ) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3BBZ) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3BBZ)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|