3B2G - JenaLib

Title :   LEPTOLYNGBYA BORYANA FERREDOXIN

Authors :   G. Kurisu, T. Hase

Date :   01 Aug 11 (Deposition) - 13 Jun 12 (Release) - 13 Jun 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.76

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Electron Transfer, Fnr, Nir, Sir, Fd-Gogat, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Sakakibara, H. Kimura, A. Iwamura, T. Saitoh, T. Ikegami, G. Kurisu T. Hase
A New Structural Insight Into Differential Interaction Of Cyanobacterial And Plant Ferredoxins With Nitrite Reductase As Revealed By Nmr And X-Ray Crystallographic Studies
J. Biochem. V. 151 483 2012
PubMed-ID: 22427434 | Reference-DOI: 10.1093/JB/MVS028

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	2FE2S_FER_2	PS51085	2Fe-2S ferredoxin-type iron-sulfur binding domain profile.	FER1_LEPBY	4-96	2	A:3-95 B:3-95
2	2FE2S_FER_1	PS00197	2Fe-2S ferredoxin-type iron-sulfur binding region signature.	FER1_LEPBY	42-50	2	A:41-49 B:41-49

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	2FE2S_FER_2	PS51085	2Fe-2S ferredoxin-type iron-sulfur binding domain profile.	FER1_LEPBY	4-96	1	A:3-95 -
2	2FE2S_FER_1	PS00197	2Fe-2S ferredoxin-type iron-sulfur binding region signature.	FER1_LEPBY	42-50	1	A:41-49 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	2FE2S_FER_2	PS51085	2Fe-2S ferredoxin-type iron-sulfur binding domain profile.	FER1_LEPBY	4-96	1	- B:3-95
2	2FE2S_FER_1	PS00197	2Fe-2S ferredoxin-type iron-sulfur binding region signature.	FER1_LEPBY	42-50	1	- B:41-49

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:98
 aligned with FER1_LEPBY | Q51577 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:98
                                    11        21        31        41        51        61        71        81        91        
            FER1_LEPBY    2 PSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVDQSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQEEDLY 99
               SCOP domains d3b2ga_ A: automated matches                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeehhhheeeeeeee...hhhhhhhhh................eeeeee..ee.......hhhhhhh.eee.hhhee...eeee..hhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --2FE2S_FER_2  PDB: A:3-95 UniProt: 4-96                                                       --- PROSITE (1)
                PROSITE (2) ----------------------------------------2FE2S_FER------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                  3b2g A  1 PSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVDQSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQEEDLY 98
                                    10        20        30        40        50        60        70        80        90

Chain B from PDB  Type:PROTEIN  Length:98
 aligned with FER1_LEPBY | Q51577 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:98
                                    11        21        31        41        51        61        71        81        91        
            FER1_LEPBY    2 PSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVDQSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQEEDLY 99
               SCOP domains d3b2gb_ B: automated matches                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee....eeeeeeee...hhhhhhhhh.................eeeee..ee.......hhhhhhh.eehhhhhee...eeee..hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --2FE2S_FER_2  PDB: B:3-95 UniProt: 4-96                                                       --- PROSITE (1)
                PROSITE (2) ----------------------------------------2FE2S_FER------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                  3b2g B  1 PSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVDQSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQEEDLY 98
                                    10        20        30        40        50        60        70        80        90

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Asymmetric Unit(hide GO term definitions)

Chain A,B (FER1_LEPBY | Q51577)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0022900	electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FES	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3b2g)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3b2g
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FER1_LEPBY \| Q51577
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description