Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  MURINE VALPHA 10 VBETA 8.1 T-CELL RECEPTOR
 
Authors :  O. Patel, J. Rossjohn
Date :  11 Apr 11  (Deposition) - 03 Aug 11  (Release) - 03 Aug 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B,G,H
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  G,H  (1x)
Keywords :  Immunoglobulin Fold, T-Cell Receptor, Cd1D Binding, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. P. Uldrich, O. Patel, G. Cameron, D. G. Pellicci, E. B. Day, L. C. Sullivan, K. Kyparissoudis, L. Kjer-Nielsen, J. P. Vivian, B. Cao, A. G. Brooks, S. J. Williams, P. Illarionov, G. S. Besra, S. J. Turner, S. A. Porcelli, J. Mccluskey, M. J. Smyth, J. Rossjohn, D. I. Godfrey
A Semi-Invariant V(Alpha)10(+) T Cell Antigen Receptor Defines A Population Of Natural Killer T Cells With Distinc Glycolipid Antigen-Recognition Properties
Nat. Immunol. V. 12 616 2011
PubMed-ID: 21666690  |  Reference-DOI: 10.1038/NI.2051

(-) Compounds

Molecule 1 - VALPHA 10
    Chains: A, G
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-30
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
 
Molecule 2 - VBETA 8.1
    Chains: B, H
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-30
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Common: MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABGH
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3AXL)

(-) Sites  (0, 0)

(no "Site" information available for 3AXL)

(-) SS Bonds  (10, 10)

Asymmetric Unit
No.Residues
1A:23 -A:104
2A:151 -A:201
3A:176 -B:184
4B:23 -B:104
5B:158 -B:223
6G:23 -G:104
7G:151 -G:201
8G:176 -H:184
9H:23 -H:104
10H:158 -H:223

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Ser A:7 -Pro A:8
2Thr B:46 -Gly B:47
3Tyr B:164 -Pro B:165
4Ser G:7 -Pro G:8
5Ser G:84A-Asn G:84B
6Ser H:7 -Pro H:8
7Thr H:46 -Gly H:47
8Tyr H:164 -Pro H:165

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3AXL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3AXL)

(-) Exons   (0, 0)

(no "Exon" information available for 3AXL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:183
                                                                                                                                                                                                                       
               SCOP domains d3axla1 A:3-129 automated matches                                                                    d3axla2 A:130-218 automated matches                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeeee....eeeeeee.....eeeeeee......eeee..ee...eeee...eeeeee...hhhhheeeeeeee.......ee...eeeeee........eeee....eeee................ee...eeeee....eeeeeeeee......................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3axl A   3 QVEQSPASLVLQEGENAELQCTYSTTLNSMQWFYQRPGGRLVSLLYEQRGGRLTSSAASRSSLHISSSQITDSGTYLCAIASSSFSKLVFGQGTSLSVVPNIQNPDPAVYQLRDVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS 218
                                    12        22        32|       49     || 64| ||    86        96       106   ||  118       128       138   ||  155       165       175       185       195       205       215   
                                                        32|             55| 64| ||                           110|                          142|                                                                    
                                                         40              61  70 ||                            113                           150                                                                    
                                                                               72|                                                                                                                                 
                                                                                80                                                                                                                                 


Chain B from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains d3axlb1 B:3-129 automated matches                                                                              d3axlb2 B:130-256 automated matches                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeeee....eeeeee......eeeeeee.....eeeeeee......ee.......eee.....eeeeee...hhhhheeeeeeee.....eee...eeeeee.hhhhh...eeeee..hhhhhhhhheeeeeeeeeee....eeeeeee..eee...eee....ee.........eeeeeeeeeehhhhh....eeeeeeee..................eeeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3axl B   3 AVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASRLGGYEQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA 256
                                    12        22        32|       49        59     || 73    ||  84   ||   95       105   ||  118       128       138       148       158       168       178       188       198       208       218       228       238       248        
                                                        32|                       65|      78|      88|                109|                                                                                                                                               
                                                         40                        70       80       90                 113                                                                                                                                               


Chain G from PDB  Type:PROTEIN  Length:190
                                                                                                                                                                                                                              
               SCOP domains d3axlg1 G:3-129 automated matches                                                                          d3axlg2 G:130-218 automated matches                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeeee....eeeeeee.....eeeeeee......eeeeeee..ee...eeee.....eeeeeee...hhhhheeeeeeee.......ee...eeeeee........eeeee...eeeee................ee...eeeee....eeeeeeeee......................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3axl G   3 QVEQSPASLVLQEGENAELQCTYSTTLNSMQWFYQRPGGRLVSLLYSPSEQRGGRLTSSAASNESRSSLHISSSQITDSGTYLCAIASSSFSKLVFGQGTSLSVVPNIQNPDPAVYQLRDSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS 218
                                    12        22        32|       49        61  || || 83 |||    90       100       110|      122       132       142|      158       168       178       188       198       208       218
                                                        32|                58| 64| ||  84A||                       110|                          142|                                                                     
                                                         40                 61  70 ||   84B|                        113                           149                                                                     
                                                                                  72|    84C                                                                                                                              
                                                                                   80                                                                                                                                     


Chain H from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains d3axlh1 H:3-129 automated matches                                                                              d3axlh2 H:130-256 automated matches                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeeee....eeeeee......eeeeeee.....eeeeeee......ee.......eee.....eeeeee...hhhhheeeeeeee.....eee...eeeeee.hhhhh...eeeee..hhhhhhhhheeeeeeeeeee....eeeeeee..ee....eee....ee.........eeeeeeeeeehhhhh....eeeeeeee..................eeeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3axl H   3 AVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASRLGGYEQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA 256
                                    12        22        32|       49        59     || 73    ||  84   ||   95       105   ||  118       128       138       148       158       168       178       188       198       208       218       228       238       248        
                                                        32|                       65|      78|      88|                109|                                                                                                                                               
                                                         40                        70       80       90                 113
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3AXL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3AXL)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3AXL)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3axl)
 
  Sites
(no "Sites" information available for 3axl)
 
  Cis Peptide Bonds
    Ser A:7 - Pro A:8   [ RasMol ]  
    Ser G:7 - Pro G:8   [ RasMol ]  
    Ser G:84A - Asn G:84B  [ RasMol ]  
    Ser H:7 - Pro H:8   [ RasMol ]  
    Thr B:46 - Gly B:47   [ RasMol ]  
    Thr H:46 - Gly H:47   [ RasMol ]  
    Tyr B:164 - Pro B:165   [ RasMol ]  
    Tyr H:164 - Pro H:165   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3axl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3AXL)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3AXL)