Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MSMEG_6394
 
Authors :  J. P. Vivian, J. Scoble, T. Beddoe, J. Rossjohn
Date :  27 May 10  (Deposition) - 11 Aug 10  (Release) - 11 Aug 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Alpha-Beta Hydrolase, Serine Esterase, Cutinase, Lipase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. K. Crellin, J. P. Vivian, J. Scoble, F. M. Chow, N. P. West, R. Brammananth, N. I. Proellocks, A. Shahine, J. Le Nours, M. C. J. Wilce, W. J. Britton, R. L. Coppel, J. Rossjohn, T. Beddoe
Functional Characterisation Of A Lipase Essential For Mycobacterial Viability
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-28B
    Expression System Strain: B834
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 36-337
    Gene: MSMEG_6394
    Organism Scientific: MYCOBACTERIUM SMEGMATIS
    Organism Taxid: 246196
    Strain: STRAIN ATCC 700084 / MC(2)155
    Synonym: MSMEG_6394 PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3AJA)

(-) Sites  (0, 0)

(no "Site" information available for 3AJA)

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1A:73 -A:165
2A:265 -A:272
3B:73 -B:165
4B:265 -B:272

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:194 -Pro A:195
2Gly B:194 -Pro B:195

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3AJA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3AJA)

(-) Exons   (0, 0)

(no "Exon" information available for 3AJA)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:260
 aligned with A0R619_MYCS2 | A0R619 from UniProtKB/TrEMBL  Length:337

    Alignment length:264
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330    
         A0R619_MYCS2    71 ADCPDVMMVSIPGTWESSPTDDPFNPTQFPLSLMSNISKPLAEQFGPDRLQVYTTPYTAQFHNPFAADKQMSYNDSRAEGMRTTVKAMTDMNDRCPLTSYVIAGFSQGAVIAGDIASDIGNGRGPVDEDLVLGVTLIADGRRQMGVGQDVGPNPAGQGAEITLHEVPALSALGLTMTGPRPGGFGALDNRTNQICGSGDLICSAPEQAFSVFNLPKTLETLSGSAAGPVHALYNTPQFWVENGQTATQWTLEWARNLVENAPHP 334
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeee......................hhhhhhhhhhhh....eeeee.................hhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhh.....hhh.eeeeeee..........ee........hhhhhh..hhhhhhh...........hhhhh..eeee..........hhhhh...hhhhhhhhhhh----............ee..eehhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3aja A  71 ADCPDVMMVSIPGTWESSPTDDPFNPTQFPLSLMSNISKPLAEQFGPDRLQVYTTPYTAQFHNPFAADKQMSYNDSRAEGMRTTVKAMTDMNDRCPLTSYVIAGFSQGAVIAGDIASDIGNGRGPVDEDLVLGVTLIADGRRQMGVGQDVGPNPAGQGAEITLHEVPALSALGLTMTGPRPGGFGALDNRTNQICGSGDLICSAPEQAFSVFNLPKTLETLSG----PVHALYNTPQFWVENGQTATQWTLEWARNLVENAPHP 334
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290  |    300       310       320       330    
                                                                                                                                                                                                                                                        293  298                                    


Chain B from PDB  Type:PROTEIN  Length:264
 aligned with A0R619_MYCS2 | A0R619 from UniProtKB/TrEMBL  Length:337

    Alignment length:264
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330    
         A0R619_MYCS2    71 ADCPDVMMVSIPGTWESSPTDDPFNPTQFPLSLMSNISKPLAEQFGPDRLQVYTTPYTAQFHNPFAADKQMSYNDSRAEGMRTTVKAMTDMNDRCPLTSYVIAGFSQGAVIAGDIASDIGNGRGPVDEDLVLGVTLIADGRRQMGVGQDVGPNPAGQGAEITLHEVPALSALGLTMTGPRPGGFGALDNRTNQICGSGDLICSAPEQAFSVFNLPKTLETLSGSAAGPVHALYNTPQFWVENGQTATQWTLEWARNLVENAPHP 334
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeee......................hhhhhhhhhhhh....eeeee.................hhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhh.....hhh.eeeeeee..........ee........hhhhhh..hhhhhhh...........hhhhh..eeee..........hhhhh...hhhhhhhhhhh...hhhhhhhhh....ee..eehhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3aja B  71 ADCPDVMMVSIPGTWESSPTDDPFNPTQFPLSLMSNISKPLAEQFGPDRLQVYTTPYTAQFHNPFAADKQMSYNDSRAEGMRTTVKAMTDMNDRCPLTSYVIAGFSQGAVIAGDIASDIGNGRGPVDEDLVLGVTLIADGRRQMGVGQDVGPNPAGQGAEITLHEVPALSALGLTMTGPRPGGFGALDNRTNQICGSGDLICSAPEQAFSVFNLPKTLETLSGSAAGPVHALYNTPQFWVENGQTATQWTLEWARNLVENAPHP 334
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3AJA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3AJA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3AJA)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (A0R619_MYCS2 | A0R619)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3aja)
 
  Sites
(no "Sites" information available for 3aja)
 
  Cis Peptide Bonds
    Gly A:194 - Pro A:195   [ RasMol ]  
    Gly B:194 - Pro B:195   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3aja
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0R619_MYCS2 | A0R619
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0R619_MYCS2 | A0R619
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3AJA)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3AJA)