|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (12, 12)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3ZXC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ZXC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3ZXC) |
Exons (0, 0)| (no "Exon" information available for 3ZXC) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:71 aligned with SIBD1_CUPSA | G4V4F9 from UniProtKB/Swiss-Prot Length:97 Alignment length:78 29 39 49 59 69 79 89 SIBD1_CUPSA 20 FTCPECRPELCGDPGYCEYGTTKDACDCCPVCFQGPGGYCGGPEDVFGICADGFACVPLVGERDSQDPEIVGTCVKIP 97 SCOP domains ------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 3zxc A 1 FTCPECRPELCGDPGYCEYGTTKDACDCCPVCFQGPGGYCGGPEDVFGICADGFACVPLV------DP-IVGTCVKIP 78 10 20 30 40 50 60 ||70 60 67| | 68 | 70 Chain B from PDB Type:PROTEIN Length:74 aligned with SIBD1_CUPSA | G4V4F9 from UniProtKB/Swiss-Prot Length:97 Alignment length:78 29 39 49 59 69 79 89 SIBD1_CUPSA 20 FTCPECRPELCGDPGYCEYGTTKDACDCCPVCFQGPGGYCGGPEDVFGICADGFACVPLVGERDSQDPEIVGTCVKIP 97 SCOP domains ------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 3zxc B 1 FTCPECRPELCGDPGYCEYGTTKDACDCCPVCFQGPGGYCGGPEDVFGICADGFACVPLVGERD---P-IVGTCVKIP 78 10 20 30 40 50 60 | |70 64 68 | 70
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3ZXC) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3ZXC) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3ZXC) |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SIBD1_CUPSA | G4V4F9)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|