Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  RNASE PO1 COMPLEXED WITH 3'GMP
 
Authors :  Y. Hara, T. Katsutani, H. Kobayashi, M. Suzuki
Date :  13 Feb 14  (Deposition) - 18 Feb 15  (Release) - 18 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Keywords :  Rnase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Hara, T. Katsutani, H. Kobayashi, M. Suzuki
Rnase Po1 Complexed With 3'Gmp
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GUANYL-SPECIFIC RIBONUCLEASE PO1
    Chains: A, B, C, D, E, F
    EC Number: 3.1.27.3
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Common: OYSTER MUSHROOM
    Organism Scientific: PLEUROTUS OSTREATUS
    Organism Taxid: 5322
    Synonym: RNASE PO1

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): A     
Biological Unit 2 (1x):  B    
Biological Unit 3 (1x):   C   
Biological Unit 4 (1x):    D  
Biological Unit 5 (1x):     E 
Biological Unit 6 (1x):      F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric Unit (1, 6)
No.NameCountTypeFull Name
13GP6Ligand/IonGUANOSINE-3'-MONOPHOSPHATE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
13GP1Ligand/IonGUANOSINE-3'-MONOPHOSPHATE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
13GP1Ligand/IonGUANOSINE-3'-MONOPHOSPHATE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
13GP1Ligand/IonGUANOSINE-3'-MONOPHOSPHATE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
13GP1Ligand/IonGUANOSINE-3'-MONOPHOSPHATE
Biological Unit 5 (1, 1)
No.NameCountTypeFull Name
13GP1Ligand/IonGUANOSINE-3'-MONOPHOSPHATE
Biological Unit 6 (1, 1)
No.NameCountTypeFull Name
13GP1Ligand/IonGUANOSINE-3'-MONOPHOSPHATE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:5 , TYR A:34 , HIS A:36 , VAL A:37 , TYR A:38 , ASN A:39 , ASN A:40 , PHE A:41 , GLU A:42 , GLU A:54 , ARG A:80 , ASN A:94 , PHE A:96 , HOH A:305 , HOH A:307 , HOH A:308 , HOH A:332 , HOH A:355 , HOH A:400 , PHE B:41BINDING SITE FOR RESIDUE 3GP A 201
2AC2SOFTWAREPHE A:41 , TYR B:34 , HIS B:36 , VAL B:37 , TYR B:38 , ASN B:39 , ASN B:40 , PHE B:41 , GLU B:42 , GLU B:54 , ASN B:94 , PHE B:96 , HOH B:345 , HOH B:386BINDING SITE FOR RESIDUE 3GP B 201
3AC3SOFTWAREHIS C:36 , VAL C:37 , TYR C:38 , ASN C:39 , ASN C:40 , PHE C:41 , GLU C:42 , GLU C:54 , ASN C:94 , PHE C:96 , HOH C:305 , HOH C:321 , HOH C:344 , HOH C:389 , PHE D:41 , GLY E:3 , ARG E:5 , ARG E:80 , HOH E:327BINDING SITE FOR RESIDUE 3GP C 201
4AC4SOFTWAREPHE C:41 , TYR D:34 , HIS D:36 , VAL D:37 , TYR D:38 , ASN D:39 , ASN D:40 , PHE D:41 , GLU D:42 , GLU D:54 , ASN D:94 , PHE D:96 , HOH D:315 , HOH D:360BINDING SITE FOR RESIDUE 3GP D 201
5AC5SOFTWAREARG C:5 , ARG C:80 , HOH C:322 , HIS E:36 , VAL E:37 , TYR E:38 , ASN E:39 , ASN E:40 , PHE E:41 , GLU E:42 , GLU E:54 , ASN E:94 , PHE E:96 , HOH E:307 , HOH E:323 , HOH E:337 , HOH E:343 , PHE F:41BINDING SITE FOR RESIDUE 3GP E 201
6AC6SOFTWAREPHE E:41 , HIS F:36 , VAL F:37 , TYR F:38 , ASN F:39 , ASN F:40 , PHE F:41 , GLU F:42 , GLU F:54 , ASN F:94 , PHE F:96 , HOH F:304 , HOH F:381BINDING SITE FOR RESIDUE 3GP F 201

(-) SS Bonds  (18, 18)

Asymmetric Unit
No.Residues
1A:7 -A:84
2A:9 -A:99
3A:48 -A:82
4B:7 -B:84
5B:9 -B:99
6B:48 -B:82
7C:7 -C:84
8C:9 -C:99
9C:48 -C:82
10D:7 -D:84
11D:9 -D:99
12D:48 -D:82
13E:7 -E:84
14E:9 -E:99
15E:48 -E:82
16F:7 -F:84
17F:9 -F:99
18F:48 -F:82

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Tyr A:34 -Pro A:35
2Pro A:50 -Thr A:51
3Tyr B:34 -Pro B:35
4Pro B:50 -Thr B:51
5Tyr C:34 -Pro C:35
6Pro C:50 -Thr C:51
7Tyr D:34 -Pro D:35
8Pro D:50 -Thr D:51
9Tyr E:34 -Pro E:35
10Pro E:50 -Thr E:51
11Tyr F:34 -Pro F:35
12Pro F:50 -Thr F:51

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3WR2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3WR2)

(-) Exons   (0, 0)

(no "Exon" information available for 3WR2)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeehhhhhhhhhhhhhh.......eee.............eeeee..............eeeeee....eeeeee..........ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 3wr2 A   1 QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF 101
                                    10        20        30        40        50        60        70        80        90       100 


Chain B from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeehhhhhhhhhhhhhh.......eee.............eeeee..............eeeeee....eeeeee..........ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 3wr2 B   1 QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF 101
                                    10        20        30        40        50        60        70        80        90       100 


Chain C from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeehhhhhhhhhhhhhh.......eee.............eeeee..............eeeeee....eeeeee..........ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 3wr2 C   1 QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF 101
                                    10        20        30        40        50        60        70        80        90       100 


Chain D from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeehhhhhhhhhhhhhh.......eee.............eeeee..............eeeeee....eeeeee..........ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 3wr2 D   1 QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF 101
                                    10        20        30        40        50        60        70        80        90       100 


Chain E from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeehhhhhhhhhhhhhh.......eee.............eeeee..............eeeeee....eeeeee..........ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 3wr2 E   1 QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF 101
                                    10        20        30        40        50        60        70        80        90       100 


Chain F from PDB  Type:PROTEIN  Length:101
                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeehhhhhhhhhhhhhh.......eee.............eeeee..............eeeeee....eeeeee..........ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 3wr2 F   1 QTGVRSCNCAGRSFTGTDVTNAIRSARAGGSGNYPHVYNNFEGFSFSCTPTFFEFPVFRGSVYSGGSPGADRVIYDQSGRFCACLTHTGAPSTNGFVECRF 101
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3WR2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3WR2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3WR2)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3GP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:50 - Thr A:51   [ RasMol ]  
    Pro B:50 - Thr B:51   [ RasMol ]  
    Pro C:50 - Thr C:51   [ RasMol ]  
    Pro D:50 - Thr D:51   [ RasMol ]  
    Pro E:50 - Thr E:51   [ RasMol ]  
    Pro F:50 - Thr F:51   [ RasMol ]  
    Tyr A:34 - Pro A:35   [ RasMol ]  
    Tyr B:34 - Pro B:35   [ RasMol ]  
    Tyr C:34 - Pro C:35   [ RasMol ]  
    Tyr D:34 - Pro D:35   [ RasMol ]  
    Tyr E:34 - Pro E:35   [ RasMol ]  
    Tyr F:34 - Pro F:35   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format | Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3wr2
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RNPO_PLEOS | P81762
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.27.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RNPO_PLEOS | P81762
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RNPO_PLEOS | P81762: 3who

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3WR2)