Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF WILD TYPE HRTR IN THE APO FORM WITH THE TARGET DNA.
 
Authors :  H. Sawai, H. Sugimoto, Y. Shiro, S. Aono
Date :  27 Jan 12  (Deposition) - 25 Jul 12  (Release) - 12 Sep 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,U
Biol. Unit 1:  A,U  (2x)
Keywords :  Heme, Sensor Protein, Tetr Superfamily, Dna-Binding Complex, Transcription-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Sawai, M. Yamanaka, H. Sugimoto, Y. Shiro, S. Aono
Structural Basis For The Transcriptional Regulation Of Heme Homeostasis In Lactococcus Lactis.
J. Biol. Chem. V. 287 30755 2012
PubMed-ID: 22798069  |  Reference-DOI: 10.1074/JBC.M112.370916

(-) Compounds

Molecule 1 - TRANSCRIPTIONAL REGULATOR
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-3A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: L53789, LL0661, YGFC
    Organism Scientific: LACTOCOCCUS LACTIS
    Organism Taxid: 272623
    Strain: IL1403
 
Molecule 2 - 5'-D(*AP*TP*GP*AP*CP*AP*CP*TP*GP*TP*GP*TP*CP*AP*T)-3'
    Chains: U
    Engineered: YES
    Synthetic: YES

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AU
Biological Unit 1 (2x): AU

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3VOK)

(-) Sites  (0, 0)

(no "Site" information available for 3VOK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3VOK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3VOK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3VOK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3VOK)

(-) Exons   (0, 0)

(no "Exon" information available for 3VOK)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:176
 aligned with Q9CHR1_LACLA | Q9CHR1 from UniProtKB/TrEMBL  Length:189

    Alignment length:188
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181        
         Q9CHR1_LACLA     2 PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKPQSSATVPASENDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRKN 189
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..hhhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhhh...hhhhhhhhhhhhhhhhhh...hhhhhhhhhhh.hhhhhhhh.------------.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vok A   2 PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWK------------DNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRKN 189
                                    11        21        31        41        51        61        71        81        91       101       111       121  |      -     | 141       151       161       171       181        
                                                                                                                                                    124          137                                                    


Chain U from PDB  Type:DNA  Length:16
                                                
                 3vok U   1 ATGACACTAGTGTCAT  15
                                     9
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3VOK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VOK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VOK)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q9CHR1_LACLA | Q9CHR1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3vok)
 
  Sites
(no "Sites" information available for 3vok)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3vok)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3vok
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9CHR1_LACLA | Q9CHR1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9CHR1_LACLA | Q9CHR1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9CHR1_LACLA | Q9CHR1: 3vox 3vp5

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3VOK)