|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (3, 3)
Asymmetric/Biological Unit
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3V2L) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3V2L) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3V2L) |
Exons (0, 0)| (no "Exon" information available for 3V2L) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:120 aligned with Q7Q9J3_ANOGA | Q7Q9J3 from UniProtKB/TrEMBL Length:142 Alignment length:120 32 42 52 62 72 82 92 102 112 122 132 142 Q7Q9J3_ANOGA 23 STVEQMMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKELKCYVNCVMEMMQTMKKGKLNYDASVKQIDTIMPDELAGPMRAALDICRTVADGIKNNCDAAYVLLQCLSKNNPKFIFP 142 SCOP domains d3v2la_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript 3v2l A 1 MTVEQMMKSGEMIRSVCLGKTKVAEELVNGLRESKFADVKELKCYVNCVMEMMQTMKKGKLNYDASVKQIDTIMPDELAGPMRAALDICRTVADGIKNNCDAAYVLLQCLSKNNPKFIFP 120 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3V2L) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3V2L) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q7Q9J3_ANOGA | Q7Q9J3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|