3ULL - JenaLib

Title :   HUMAN MITOCHONDRIAL SINGLE-STRANDED DNA BINDING PROTEIN

Authors :   C. Yang, U. Curth, C. Urbanke, C. Kang

Date :   11 Dec 96 (Deposition) - 15 Oct 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Dna-Binding Protein, Dna Replication, Mitochondrion, Transit Peptide (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Yang, U. Curth, C. Urbanke, C. Kang
Crystal Structure Of Human Mitochondrial Single-Stranded Dna Binding Protein At 2. 4 A Resolution.
Nat. Struct. Biol. V. 4 153 1997
PubMed-ID: 9033597 | Reference-DOI: 10.1038/NSB0297-153
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (5, 10)

Asymmetric Unit (5, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000265304	1a	ENSE00001811854	chr7:141438121-141438210	90	SSBP_HUMAN	-	0	0	-	-
1.3a	ENST00000265304	3a	ENSE00002141807	chr7:141438924-141438990	67	SSBP_HUMAN	1-8	8	0	-	-
1.5	ENST00000265304	5	ENSE00002178642	chr7:141441969-141442029	61	SSBP_HUMAN	9-29	21	2	A:10-13 B:10-13	4 4
1.6	ENST00000265304	6	ENSE00000727735	chr7:141443361-141443501	141	SSBP_HUMAN	29-76	48	2	A:13-51 B:13-51	39 39
1.7	ENST00000265304	7	ENSE00000727739	chr7:141443702-141443789	88	SSBP_HUMAN	76-105	30	2	A:61-89 B:65-89	29 25
1.8b	ENST00000265304	8b	ENSE00000872183	chr7:141445296-141445384	89	SSBP_HUMAN	105-135	31	2	A:89-119 B:89-119	31 31
1.9f	ENST00000265304	9f	ENSE00001845616	chr7:141450111-141450261	151	SSBP_HUMAN	135-148	14	2	A:119-124 B:119-125	6 7

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with SSBP_HUMAN | Q04837 from UniProtKB/Swiss-Prot  Length:148

    Alignment length:115
                                    35        45        55        65        75        85        95       105       115       125       135     
           SSBP_HUMAN    26 LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL 140
               SCOP domains d3ulla_ A: ssDNA-binding protein                                                                                    SCOP domains
               CATH domains 3ullA00 A:10-124 Nucleic acid-binding prot         eins                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeee.....eee.......eeeeeeeeeeee..---------..eeeeeeeeeee....hhhhhhhh.....eeeeeeeee..............eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----SSB  PDB: A:14-124 UniProt: 30-141                                                                              PROSITE
           Transcript 1 (1) 1.5 ----------------------------------------------Exon 1.7  PDB: A:61-89        -----------------------------1.9f   Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.6  PDB: A:13-51 UniProt: 29-76           ----------------------------Exon 1.8b  PDB: A:89-119       ----- Transcript 1 (2)
                 3ull A  10 LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRS---------DVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL 124
                                    19        29        39        49 |       - |      69        79        89        99       109       119     
                                                                    51        61

Chain B from PDB  Type:PROTEIN  Length:103
 aligned with SSBP_HUMAN | Q04837 from UniProtKB/Swiss-Prot  Length:148

    Alignment length:116
                                    35        45        55        65        75        85        95       105       115       125       135      
           SSBP_HUMAN    26 LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLS 141
               SCOP domains d3ullb_ B: ssDNA-binding protein                                                                                     SCOP domains
               CATH domains 3ullB00 B:10-125 Nucleic acid-binding prot             eins                                                          CATH domains
           Pfam domains (1) ----SSB-3ullB01 B:14-124                                                                                           - Pfam domains (1)
           Pfam domains (2) ----SSB-3ullB02 B:14-124                                                                                           - Pfam domains (2)
         Sec.struct. author ....eeeeeeeee.....eeee.....eeeeeeeeee.....-------------.eeeeeeee....hhhhhhhh.....eeeeeeeee..............eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----SSB  PDB: B:14-125 UniProt: 30-141                                                                               PROSITE
           Transcript 1 (1) 1.5 ----------------------------------------------Exon 1.7  PDB: B:65-89        -----------------------------1.9f    Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.6  PDB: B:13-51 UniProt: 29-76           ----------------------------Exon 1.8b  PDB: B:89-119       ------ Transcript 1 (2)
                 3ull B  10 LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRS-------------KTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLS 125
                                    19        29        39        49 |       -     |  69        79        89        99       109       119      
                                                                    51            65

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (13, 13)

Asymmetric Unit(hide GO term definitions)

Chain A,B (SSBP_HUMAN | Q04837)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003697	single-stranded DNA binding	Interacting selectively and non-covalently with single-stranded DNA.
biological process
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0070584	mitochondrion morphogenesis	The process in which the anatomical structures of a mitochondrion are generated and organized.
	GO:0007005	mitochondrion organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a mitochondrion; includes mitochondrial morphogenesis and distribution, and replication of the mitochondrial genome as well as synthesis of new mitochondrial components.
	GO:0051096	positive regulation of helicase activity	Any process that activates or increases the activity of a helicase.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0042645	mitochondrial nucleoid	The region of a mitochondrion to which the DNA is confined.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3ull)

	Sites
(no "Sites" information available for 3ull)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ull)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3ull
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SSBP_HUMAN \| Q04837
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description