3TNU - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HETEROCOMPLEX OF COIL 2B DOMAINS OF HUMAN INTERMEDIATE FILAMENT PROTEINS, KERATIN 5 (KRT5) AND KERATIN 14 (KRT14)

Authors :   C. H. Lee, M. S. Kim, D. J. Leahy, P. A. Coulombe

Date :   02 Sep 11 (Deposition) - 20 Jun 12 (Release) - 01 Aug 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)
Biol. Unit 2: A,B  (1x)

Keywords :   Coiled-Coil, Structural Support, Cytosolic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. H. Lee, M. S. Kim, B. M. Chung, D. J. Leahy, P. A. Coulombe
Structural Basis For Heteromeric Assembly And Perinuclear Organization Of Keratin Filaments.
Nat. Struct. Mol. Biol. V. 19 707 2012
PubMed-ID: 22705788 | Reference-DOI: 10.1038/NSMB.2330

Molecule 1 - KERATIN, TYPE I CYTOSKELETAL 14
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 295-422
	Gene	:	KRT14
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CYTOKERATIN-14, CK-14, KERATIN-14, K14

Molecule 2 - KERATIN, TYPE II CYTOSKELETAL 5
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 350-477
	Gene	:	KRT5
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	58 KDA CYTOKERATIN, CYTOKERATIN-5, CK-5, KERATIN-5, K5, TYPE-II KERATIN KB5

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B
Biological Unit 2 (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3TNU)

(no "Site" information available for 3TNU)

Asymmetric Unit

No.	Residues
1	A:367	-	A:367

(no "Cis Peptide Bond" information available for 3TNU)

Asymmetric Unit (22, 22)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_010450	I	377	N	K1C14_HUMAN	Disease (WC-EBS)	61536893	A	I	377	N
02	UniProt	VAR_003843	L	384	P	K1C14_HUMAN	Disease (K-EBS)	59629244	A	L	384	P
03	UniProt	VAR_028766	S	387	T	K2C5_HUMAN	Polymorphism	2669875	B	S	387	T
04	UniProt	VAR_010451	R	388	C	K1C14_HUMAN	Disease (WC-EBS)	59966597	A	R	388	C
05	UniProt	VAR_031637	R	388	H	K1C14_HUMAN	Disease (WC-EBS)	58645163	A	R	388	H
06	UniProt	VAR_023726	K	404	E	K2C5_HUMAN	Disease (WC-EBS)	60809982	B	K	404	E
07	UniProt	VAR_023724	L	408	M	K1C14_HUMAN	Disease (WC-EBS)	57200223	A	L	408	M
08	UniProt	VAR_023725	A	413	T	K1C14_HUMAN	Disease (K-EBS)	59780231	A	A	413	T
09	UniProt	VAR_031638	Y	415	C	K1C14_HUMAN	Disease (WC-EBS)	59442925	A	Y	415	C
10	UniProt	VAR_003844	Y	415	H	K1C14_HUMAN	Disease (K-EBS)	58380626	A	Y	415	H
11	UniProt	VAR_031639	R	416	P	K1C14_HUMAN	Disease (DM-EBS)	60622724	A	R	416	P
12	UniProt	VAR_027721	R	417	P	K1C14_HUMAN	Disease (DM-EBS)	61085704	A	R	417	P
13	UniProt	VAR_026544	E	418	K	K2C5_HUMAN	Disease (K-EBS)	121912476	B	E	418	K
14	UniProt	VAR_071705	L	418	Q	K1C14_HUMAN	Disease	---	A	L	418	Q
15	UniProt	VAR_003845	L	419	Q	K1C14_HUMAN	Disease (DM-EBS)	57364972	A	L	419	Q
16	UniProt	VAR_071633	A	428	T	K2C5_HUMAN	Disease (WC-EBS)	267607458	B	A	428	T
17	UniProt	VAR_023727	A	438	D	K2C5_HUMAN	Disease (WC-EBS)	57845028	B	A	438	D
18	UniProt	VAR_003876	L	463	P	K2C5_HUMAN	Disease (K-EBS)	57599352	B	L	463	P
19	UniProt	VAR_010466	I	467	T	K2C5_HUMAN	Disease (DM-EBS)	60271599	B	I	467	T
20	UniProt	VAR_027726	T	469	P	K2C5_HUMAN	Disease (DM-EBS)	60596287	B	T	469	P
21	UniProt	VAR_003877	E	475	G	K2C5_HUMAN	Disease (DM-EBS)	61348633	B	E	475	G
22	UniProt	VAR_023728	E	475	K	K2C5_HUMAN	Disease (DM-EBS)	57155193	B	E	475	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (22, 44)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_010450	I	377	N	K1C14_HUMAN	Disease (WC-EBS)	61536893	A	I	377	N
02	UniProt	VAR_003843	L	384	P	K1C14_HUMAN	Disease (K-EBS)	59629244	A	L	384	P
03	UniProt	VAR_028766	S	387	T	K2C5_HUMAN	Polymorphism	2669875	B	S	387	T
04	UniProt	VAR_010451	R	388	C	K1C14_HUMAN	Disease (WC-EBS)	59966597	A	R	388	C
05	UniProt	VAR_031637	R	388	H	K1C14_HUMAN	Disease (WC-EBS)	58645163	A	R	388	H
06	UniProt	VAR_023726	K	404	E	K2C5_HUMAN	Disease (WC-EBS)	60809982	B	K	404	E
07	UniProt	VAR_023724	L	408	M	K1C14_HUMAN	Disease (WC-EBS)	57200223	A	L	408	M
08	UniProt	VAR_023725	A	413	T	K1C14_HUMAN	Disease (K-EBS)	59780231	A	A	413	T
09	UniProt	VAR_031638	Y	415	C	K1C14_HUMAN	Disease (WC-EBS)	59442925	A	Y	415	C
10	UniProt	VAR_003844	Y	415	H	K1C14_HUMAN	Disease (K-EBS)	58380626	A	Y	415	H
11	UniProt	VAR_031639	R	416	P	K1C14_HUMAN	Disease (DM-EBS)	60622724	A	R	416	P
12	UniProt	VAR_027721	R	417	P	K1C14_HUMAN	Disease (DM-EBS)	61085704	A	R	417	P
13	UniProt	VAR_026544	E	418	K	K2C5_HUMAN	Disease (K-EBS)	121912476	B	E	418	K
14	UniProt	VAR_071705	L	418	Q	K1C14_HUMAN	Disease	---	A	L	418	Q
15	UniProt	VAR_003845	L	419	Q	K1C14_HUMAN	Disease (DM-EBS)	57364972	A	L	419	Q
16	UniProt	VAR_071633	A	428	T	K2C5_HUMAN	Disease (WC-EBS)	267607458	B	A	428	T
17	UniProt	VAR_023727	A	438	D	K2C5_HUMAN	Disease (WC-EBS)	57845028	B	A	438	D
18	UniProt	VAR_003876	L	463	P	K2C5_HUMAN	Disease (K-EBS)	57599352	B	L	463	P
19	UniProt	VAR_010466	I	467	T	K2C5_HUMAN	Disease (DM-EBS)	60271599	B	I	467	T
20	UniProt	VAR_027726	T	469	P	K2C5_HUMAN	Disease (DM-EBS)	60596287	B	T	469	P
21	UniProt	VAR_003877	E	475	G	K2C5_HUMAN	Disease (DM-EBS)	61348633	B	E	475	G
22	UniProt	VAR_023728	E	475	K	K2C5_HUMAN	Disease (DM-EBS)	57155193	B	E	475	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (22, 22)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_010450	I	377	N	K1C14_HUMAN	Disease (WC-EBS)	61536893	A	I	377	N
02	UniProt	VAR_003843	L	384	P	K1C14_HUMAN	Disease (K-EBS)	59629244	A	L	384	P
03	UniProt	VAR_028766	S	387	T	K2C5_HUMAN	Polymorphism	2669875	B	S	387	T
04	UniProt	VAR_010451	R	388	C	K1C14_HUMAN	Disease (WC-EBS)	59966597	A	R	388	C
05	UniProt	VAR_031637	R	388	H	K1C14_HUMAN	Disease (WC-EBS)	58645163	A	R	388	H
06	UniProt	VAR_023726	K	404	E	K2C5_HUMAN	Disease (WC-EBS)	60809982	B	K	404	E
07	UniProt	VAR_023724	L	408	M	K1C14_HUMAN	Disease (WC-EBS)	57200223	A	L	408	M
08	UniProt	VAR_023725	A	413	T	K1C14_HUMAN	Disease (K-EBS)	59780231	A	A	413	T
09	UniProt	VAR_031638	Y	415	C	K1C14_HUMAN	Disease (WC-EBS)	59442925	A	Y	415	C
10	UniProt	VAR_003844	Y	415	H	K1C14_HUMAN	Disease (K-EBS)	58380626	A	Y	415	H
11	UniProt	VAR_031639	R	416	P	K1C14_HUMAN	Disease (DM-EBS)	60622724	A	R	416	P
12	UniProt	VAR_027721	R	417	P	K1C14_HUMAN	Disease (DM-EBS)	61085704	A	R	417	P
13	UniProt	VAR_026544	E	418	K	K2C5_HUMAN	Disease (K-EBS)	121912476	B	E	418	K
14	UniProt	VAR_071705	L	418	Q	K1C14_HUMAN	Disease	---	A	L	418	Q
15	UniProt	VAR_003845	L	419	Q	K1C14_HUMAN	Disease (DM-EBS)	57364972	A	L	419	Q
16	UniProt	VAR_071633	A	428	T	K2C5_HUMAN	Disease (WC-EBS)	267607458	B	A	428	T
17	UniProt	VAR_023727	A	438	D	K2C5_HUMAN	Disease (WC-EBS)	57845028	B	A	438	D
18	UniProt	VAR_003876	L	463	P	K2C5_HUMAN	Disease (K-EBS)	57599352	B	L	463	P
19	UniProt	VAR_010466	I	467	T	K2C5_HUMAN	Disease (DM-EBS)	60271599	B	I	467	T
20	UniProt	VAR_027726	T	469	P	K2C5_HUMAN	Disease (DM-EBS)	60596287	B	T	469	P
21	UniProt	VAR_003877	E	475	G	K2C5_HUMAN	Disease (DM-EBS)	61348633	B	E	475	G
22	UniProt	VAR_023728	E	475	K	K2C5_HUMAN	Disease (DM-EBS)	57155193	B	E	475	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IF	PS00226	Intermediate filaments signature.	K1C14_HUMAN	412-420	1	A:412-420
1	IF	PS00226	Intermediate filaments signature.	K2C5_HUMAN	467-475	1	B:467-475

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IF	PS00226	Intermediate filaments signature.	K1C14_HUMAN	412-420	2	A:412-420
1	IF	PS00226	Intermediate filaments signature.	K2C5_HUMAN	467-475	2	B:467-475

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IF	PS00226	Intermediate filaments signature.	K1C14_HUMAN	412-420	1	A:412-420
1	IF	PS00226	Intermediate filaments signature.	K2C5_HUMAN	467-475	1	B:467-475

(no "Exon" information available for 3TNU)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:90
 aligned with K1C14_HUMAN | P02533 from UniProtKB/Swiss-Prot  Length:472

    Alignment length:90
                                   341       351       361       371       381       391       401       411       421
          K1C14_HUMAN   332 SELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEG 421
               SCOP domains ------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------------N------P---C-------------------M----T-CPPQQ-- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------------------H--------------------------H------ SAPs(SNPs) (2)
                    PROSITE --------------------------------------------------------------------------------IF       - PROSITE
                 Transcript ------------------------------------------------------------------------------------------ Transcript
                 3tnu A 332 SELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEG 421
                                   341       351       361       371       381       391       401       411       421

Chain B from PDB  Type:PROTEIN  Length:95
 aligned with K2C5_HUMAN | P13647 from UniProtKB/Swiss-Prot  Length:590

    Alignment length:95
                                   391       401       411       421       431       441       451       461       471     
           K2C5_HUMAN   382 TKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG 476
               SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) -----T----------------E-------------K---------T---------D------------------------P---T-P-----G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------K- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------IF       - PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                 3tnu B 382 TKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG 476
                                   391       401       411       421       431       441       451       461       471

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3TNU)

(no "CATH Domain" information available for 3TNU)

(no "Pfam Domain" information available for 3TNU)

Asymmetric Unit(hide GO term definitions)

Chain A (K1C14_HUMAN | P02533)

molecular function
	GO:1990254	keratin filament binding	Interacting selectively and non-covalently with a keratin filament, an intermediate filament composed of acidic and basic keratins (types I and II), typically expressed in epithelial cells.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0008544	epidermis development	The process whose specific outcome is the progression of the epidermis over time, from its formation to the mature structure. The epidermis is the outer epithelial layer of an animal, it may be a single layer that produces an extracellular material (e.g. the cuticle of arthropods) or a complex stratified squamous epithelium, as in the case of many vertebrate species.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:0042633	hair cycle	The cyclical phases of growth (anagen), regression (catagen), quiescence (telogen), and shedding (exogen) in the life of a hair; one of the collection or mass of filaments growing from the skin of an animal, and forming a covering for a part of the head or for any part or the whole of the body.
	GO:0031581	hemidesmosome assembly	Assembly of hemidesmosomes, integrin-containing protein complexes that bind to laminin in the basal lamina. Hemidesmosomes form the contact between the basal surface of epithelial cells and the underlying basal lamina.
	GO:0045110	intermediate filament bundle assembly	The formation of the bundles of intermediate filaments. Intermediate filament-associated proteins (IFAPs) cross-link intermediate filaments with one another, forming a bundle or a network, and with other cell structures, including the plasma membrane. The organization of intermediate filaments and their supportive function in various cells types depends in large part on their linkage to other cell structures via IFAPs.
	GO:0010212	response to ionizing radiation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
	GO:0010043	response to zinc ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
cellular component
	GO:0071944	cell periphery	The part of a cell encompassing the cell cortex, the plasma membrane, and any external encapsulating structures.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005882	intermediate filament	A cytoskeletal structure that forms a distinct elongated structure, characteristically 10 nm in diameter, that occurs in the cytoplasm of eukaryotic cells. Intermediate filaments form a fibrous system, composed of chemically heterogeneous subunits and involved in mechanically integrating the various components of the cytoplasmic space. Intermediate filaments may be divided into five chemically distinct classes: Type I, acidic keratins; Type II, basic keratins; Type III, including desmin, vimentin and others; Type IV, neurofilaments and related filaments; and Type V, lamins.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0045095	keratin filament	A filament composed of acidic and basic keratins (types I and II), typically expressed in epithelial cells. The keratins are the most diverse classes of IF proteins, with a large number of keratin isoforms being expressed. Each type of epithelium always expresses a characteristic combination of type I and type II keratins.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (K2C5_HUMAN | P13647)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0097110	scaffold protein binding	Interacting selectively and non-covalently with a scaffold protein. Scaffold proteins are crucial regulators of many key signaling pathways. Although not strictly defined in function, they are known to interact and/or bind with multiple members of a signaling pathway, tethering them into complexes.
	GO:0005200	structural constituent of cytoskeleton	The action of a molecule that contributes to the structural integrity of a cytoskeletal structure.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
	GO:0008544	epidermis development	The process whose specific outcome is the progression of the epidermis over time, from its formation to the mature structure. The epidermis is the outer epithelial layer of an animal, it may be a single layer that produces an extracellular material (e.g. the cuticle of arthropods) or a complex stratified squamous epithelium, as in the case of many vertebrate species.
	GO:0031581	hemidesmosome assembly	Assembly of hemidesmosomes, integrin-containing protein complexes that bind to laminin in the basal lamina. Hemidesmosomes form the contact between the basal surface of epithelial cells and the underlying basal lamina.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005882	intermediate filament	A cytoskeletal structure that forms a distinct elongated structure, characteristically 10 nm in diameter, that occurs in the cytoplasm of eukaryotic cells. Intermediate filaments form a fibrous system, composed of chemically heterogeneous subunits and involved in mechanically integrating the various components of the cytoplasmic space. Intermediate filaments may be divided into five chemically distinct classes: Type I, acidic keratins; Type II, basic keratins; Type III, including desmin, vimentin and others; Type IV, neurofilaments and related filaments; and Type V, lamins.
	GO:0045095	keratin filament	A filament composed of acidic and basic keratins (types I and II), typically expressed in epithelial cells. The keratins are the most diverse classes of IF proteins, with a large number of keratin isoforms being expressed. Each type of epithelium always expresses a characteristic combination of type I and type II keratins.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3tnu)

	Sites
(no "Sites" information available for 3tnu)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3tnu)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3tnu
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	K1C14_HUMAN \| P02533
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	K2C5_HUMAN \| P13647
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	131760
		Disease Information	:	OMIM
	131800
		Disease Information	:	OMIM
	131900
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	K1C14_HUMAN \| P02533
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	K2C5_HUMAN \| P13647
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 3TNU)

(no "Related Entries Specified in the PDB File" available for 3TNU)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (22, 22)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (24, 35)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File