Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TRIOSEPHOSPHATE ISOMERASE FROM RHIPICEPHALUS (BOOPHILUS) MICROPLUS.
 
Authors :  R. Arreola, A. Rodriguez-Romero, J. Moraes, A. Gomez-Puyou, R. Perez- C. Logullo
Date :  18 Aug 11  (Deposition) - 31 Aug 11  (Release) - 31 Aug 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha/Beta Barrel, Embryogenesis, Glycolysis, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Moraes, R. Arreola, N. Cabrera, L. Saramago, D. Freitas, A. Masuda, I. Da Silva Vaz, M. Tuena De Gomez-Puyou, R. Perez-Montfort, A. Gomez-Puyou, C. Logullo
Structural And Biochemical Characterization Of A Recombinan Triosephosphate Isomerase From Rhipicephalus (Boophilus) Microplus.
Insect Biochem. Mol. Biol. V. 41 400 2011
PubMed-ID: 21396445  |  Reference-DOI: 10.1016/J.IBMB.2011.02.009

(-) Compounds

Molecule 1 - TRIOSEPHOSPHATE ISOMERASE
    Chains: A, B
    EC Number: 5.3.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET3A
    Expression System Strain: BL21(DE3)PLYS
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: TIM
    Organism Common: CATTLE TICK
    Organism Scientific: RHIPICEPHALUS MICROPLUS
    Organism Taxid: 6941
    Strain: PORTO ALEGRE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3TH6)

(-) Sites  (0, 0)

(no "Site" information available for 3TH6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3TH6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3TH6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3TH6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3TH6)

(-) Exons   (0, 0)

(no "Exon" information available for 3TH6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:244
 aligned with A8B3A8_RHIMP | A8B3A8 from UniProtKB/TrEMBL  Length:249

    Alignment length:247
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       
         A8B3A8_RHIMP     3 ARRFCVGGNWKMHGSKNSIRDICNTLKGASLDPNVEVIVACPAPYLDYCRSLLPPSVALAAQNCYKVEQGAFTGEISPGMIKDCGGQWVILGHSERRHVFKEDDVLIGEKIKHALESGLNVIACIGELLEDREAGRTEEVCFRQIKHIASNVKDWSKVVIAYEPVWAIGTGKTATPDQAQEVHSKVRNWLSTNVSADVASKVRIQYGGSVNAGNCKELGRKPDIDGFLVGGASLKPEFVQIINAMQG 249
               SCOP domains d3th6a_ A: automated matches                                                                                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.....hhhhhhhhhhhhhh.......eeeeeehhhhhhhhhhhh...eeeee...............hhhhhhhh...eeee.hhhhhhh...hhhhhhhhhhhhhhh..eeeeee..hhhhhh..hhhhhhhhhhhhhhh...hhh.eeeee.......---..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee.......hhhhhhh.....eeeehhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3th6 A   3 ARRFCVGGNWKMHGSKNSIRDICNTLKGASLDPNVEVIVACPAPYLDYCRSLLPPSVALAAQNCYKVEQGAFTGEISPGMIKDCGGQWVILGHSERRHVFKEDDVLIGEKIKHALESGLNVIACIGELLEDREAGRTEEVCFRQIKHIASNVKDWSKVVIAYEPVWAIG---TATPDQAQEVHSKVRNWLSTNVSADVASKVRIQYGGSVNAGNCKELGRKPDIDGFLVGGASLKPEFVQIINAMQG 249
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162        |-  |    182       192       202       212       222       232       242       
                                                                                                                                                                                                  171 175                                                                          


Chain B from PDB  Type:PROTEIN  Length:241
 aligned with A8B3A8_RHIMP | A8B3A8 from UniProtKB/TrEMBL  Length:249

    Alignment length:246
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242      
         A8B3A8_RHIMP     3 ARRFCVGGNWKMHGSKNSIRDICNTLKGASLDPNVEVIVACPAPYLDYCRSLLPPSVALAAQNCYKVEQGAFTGEISPGMIKDCGGQWVILGHSERRHVFKEDDVLIGEKIKHALESGLNVIACIGELLEDREAGRTEEVCFRQIKHIASNVKDWSKVVIAYEPVWAIGTGKTATPDQAQEVHSKVRNWLSTNVSADVASKVRIQYGGSVNAGNCKELGRKPDIDGFLVGGASLKPEFVQIINAMQ 248
               SCOP domains d3th6b_ B: automated matches                                                                                                                                                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeee.....hhhhhhhhhhhhhh.......eeeee.hhhhhhhhhhhh...eeeee...............hhhhhhhh...eeee.hhhhhhh...hhhhhhhhhhhhhhh..eeeeee..hhhhhhh.hhhhhhhhhhhhhhh...hhh.eeeee......-----.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee.......hhhhhhhh....eeeehhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3th6 B   3 ARRFCVGGNWKMHGSKNSIRDICNTLKGASLDPNVEVIVACPAPYLDYCRSLLPPSVALAAQNCYKVEQGAFTGEISPGMIKDCGGQWVILGHSERRHVFKEDDVLIGEKIKHALESGLNVIACIGELLEDREAGRTEEVCFRQIKHIASNVKDWSKVVIAYEPVWAI-----ATPDQAQEVHSKVRNWLSTNVSADVASKVRIQYGGSVNAGNCKELGRKPDIDGFLVGGASLKPEFVQIINAMQ 248
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       | -   |   182       192       202       212       222       232       242      
                                                                                                                                                                                                 170   176
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3TH6)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3TH6)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (A8B3A8_RHIMP | A8B3A8)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0004807    triose-phosphate isomerase activity    Catalysis of the reaction: D-glyceraldehyde 3-phosphate = glycerone phosphate.
biological process
    GO:0006094    gluconeogenesis    The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0006098    pentose-phosphate shunt    The glucose-6-phosphate catabolic process in which, coupled to NADPH synthesis, glucose-6-P is oxidized with the formation of carbon dioxide (CO2) and ribulose 5-phosphate; ribulose 5-P then enters a series of reactions interconverting sugar phosphates. The pentose phosphate pathway is a major source of reducing equivalents for biosynthesis reactions and is also important for the conversion of hexoses to pentoses.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3th6)
 
  Sites
(no "Sites" information available for 3th6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3th6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3th6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A8B3A8_RHIMP | A8B3A8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  5.3.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A8B3A8_RHIMP | A8B3A8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3TH6)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3TH6)