|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 3) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3T5S) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3T5S) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3T5S) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3T5S) |
Exons (0, 0)| (no "Exon" information available for 3T5S) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:97 aligned with A8BFP4_GIAIC | A8BFP4 from UniProtKB/TrEMBL Length:114 Alignment length:102 1 | 9 19 29 39 49 59 69 79 89 99 A8BFP4_GIAIC - -MPCAIVTTNADFTKDQADAFCLDMGQVLAKETGKPVSYCMAGVRKADMSFGTSTDLCCFVDFYCIGVISQAKNPSISAAITGCLTQHFKVKPERVYISFNE 101 SCOP domains d3t5sa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------ Transcript 3t5s A 0 SMPCAIVTTNADFTKDQADAFCLDMGQVLAKETGKPVSYCMAGVRKADMSFGTSTDLCCFVDFYCIG-----KNPSISAAITGCLTQHFKVKPERVYISFNE 101 9 19 29 39 49 59 | - | 79 89 99 66 72
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3T5S) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3T5S) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3T5S)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|