Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A PUTATIVE C-S LYASE FROM BACILLUS ANTHRACIS
 
Authors :  S. M. Anderson, Z. Wawrzak, E. Gordon, S. N. Peterson, P. Porebski, W. Mi A. Savchenko, W. F. Anderson, Center For Structural Genomics Of Infectious Diseases (Csgid)
Date :  24 Jul 11  (Deposition) - 10 Aug 11  (Release) - 10 Aug 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Csgid, Center For Structural Genomics Of Infectious Diseases, Aminotransferase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. M. Anderson, Z. Wawrzak, E. Gordon, S. N. Peterson, P. Porebski, W. Minor, A. Savchenko, W. F. Anderson, Center For Structural Genomics Of Infectious Diseases (Csgid)
Crystal Structure Of A Putative C-S Lyase From Bacillus Anthracis
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - AMINOTRANSFERASE, CLASS I/II
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21-CODONPLUS(DE3)-RIPL
    Expression System Taxid: 562
    Gene: BAS4776, BA_5138, GBAA_5138
    Organism Common: ANTHRAX,ANTHRAX BACTERIUM
    Organism Scientific: BACILLUS ANTHRACIS
    Organism Taxid: 261594
    Strain: AMES ANCESTOR
    Synonym: AMINOTRANSFERASE, CLASSES I AND II, PUTATIVE C-S LYASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 14)

Asymmetric/Biological Unit (2, 14)
No.NameCountTypeFull Name
1LLP2Mod. Amino Acid2-LYSINE(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHANE)
2MSE12Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3T32)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3T32)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Pro A:113 -Pro A:114
2Ser A:164 -Pro A:165
3Asn A:167 -Pro A:168
4Pro B:113 -Pro B:114
5Ser B:164 -Pro B:165
6Asn B:167 -Pro B:168

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3T32)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3T32)

(-) Exons   (0, 0)

(no "Exon" information available for 3T32)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:360
 aligned with Q81K67_BACAN | Q81K67 from UniProtKB/TrEMBL  Length:383

    Alignment length:360
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383
         Q81K67_BACAN    24 EELIHAWIADMDFEVPQPIQTALKKRIEHPIFGYTLPPENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQKQNDTYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLSEELAARTITCMAPSKTFNIAGLQASIIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACEYIKDHIPTLSVMKPEGSFLLWIDCSALNLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRHTFS 383
               SCOP domains d3t32a_ A: automated matches                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...ee..........hhhhhhhhhhhhh...........hhhhhhhhhhhhhhh...hhh.eeee.hhhhhhhhhhhhhh....eeee.....hhhhhhhhhh..eeee...eee..eee.hhhhhhhhhhh.eeeeeee..........hhhhhhhhhhhhhhh..eeeee..............hhhhhhhhhhh.eeeee.hhhhhhhhhhh.eeee..hhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.......eeeee.hhhh.hhhhhhhhhhhh..ee.ee.hhhh.....eeeee...hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3t32 A  24 EELIHAWIADmDFEVPQPIQTALKKRIEHPIFGYTLPPENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEmVTTNNRQLCVSPLQKQNDTYAIDFEHLEKQFQQGVKLmLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLSEELAARTITCmAPSkTFNIAGLQASIIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAmQSAYTECNDWLNEIRFYIEDNAKFACEYIKDHIPTLSVmKPEGSFLLWIDCSALNLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRHTFS 383
                                    33|       43        53        63        73        83        93       103       113       123       133       143       153      |163       173       183       193       203       213       223  |   |233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383
                                     34-MSE                                                                                 122-MSE                               160-MSE                                                           226-MSE                                        273-MSE                                312-MSE                                                                   
                                                                                                                                                                                                                                        230-LLP                                                                                                                                                     


Chain B from PDB  Type:PROTEIN  Length:360
 aligned with Q81K67_BACAN | Q81K67 from UniProtKB/TrEMBL  Length:383

    Alignment length:360
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383
         Q81K67_BACAN    24 EELIHAWIADMDFEVPQPIQTALKKRIEHPIFGYTLPPENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQKQNDTYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLSEELAARTITCMAPSKTFNIAGLQASIIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACEYIKDHIPTLSVMKPEGSFLLWIDCSALNLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRHTFS 383
               SCOP domains d3t32b_ B: automated matches                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...ee..........hhhhhhhhhhhhh...........hhhhhhhhhhhhhhh...hhh.eeee.hhhhhhhhhhhhhh....eeee.....hhhhhhhhh...eeee...eee..eee.hhhhhhhhhhh...eeeee..........hhhhhhhhhhhhhhh..eeeee..............hhhhhhhhhhh.eeeee.hhhhhhhhhhh.eeee..hhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.......eeeee.hhhh.hhhhhhhhhhhh..ee.ee.hhhh.....eeeee...hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3t32 B  24 EELIHAWIADmDFEVPQPIQTALKKRIEHPIFGYTLPPENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEmVTTNNRQLCVSPLQKQNDTYAIDFEHLEKQFQQGVKLmLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLSEELAARTITCmAPSkTFNIAGLQASIIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAmQSAYTECNDWLNEIRFYIEDNAKFACEYIKDHIPTLSVmKPEGSFLLWIDCSALNLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRHTFS 383
                                    33|       43        53        63        73        83        93       103       113       123       133       143       153      |163       173       183       193       203       213       223  |   |233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383
                                     34-MSE                                                                                 122-MSE                               160-MSE                                                           226-MSE                                        273-MSE                                312-MSE                                                                   
                                                                                                                                                                                                                                        230-LLP
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3T32)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3T32)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q81K67_BACAN | Q81K67)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0030170    pyridoxal phosphate binding    Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
    GO:0008483    transaminase activity    Catalysis of the transfer of an amino group to an acceptor, usually a 2-oxo acid.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    LLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3t32)
 
  Cis Peptide Bonds
    Asn A:167 - Pro A:168   [ RasMol ]  
    Asn B:167 - Pro B:168   [ RasMol ]  
    Pro A:113 - Pro A:114   [ RasMol ]  
    Pro B:113 - Pro B:114   [ RasMol ]  
    Ser A:164 - Pro A:165   [ RasMol ]  
    Ser B:164 - Pro B:165   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3t32
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81K67_BACAN | Q81K67
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q81K67_BACAN | Q81K67
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3T32)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3T32)