Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  DICHELOBACTER NODOSUS PILIN FIMA
 
Authors :  A. S. Arvai, L. Craig, S. Hartung, T. Wood, S. Kolappan, D. S. Shin, J. A. T
Date :  30 Jun 11  (Deposition) - 02 Nov 11  (Release) - 04 Jan 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Pilus Subunit, Extracellular, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Hartung, A. S. Arvai, T. Wood, S. Kolappan, D. S. Shin, L. Craig, J. A. Tainer
Ultrahigh Resolution And Full-Length Pilin Structures With Insights For Filament Assembly, Pathogenic Functions, And Vaccine Potential.
J. Biol. Chem. V. 286 44254 2011
PubMed-ID: 22027840  |  Reference-DOI: 10.1074/JBC.M111.297242

(-) Compounds

Molecule 1 - FIMBRIAL PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemPSEUDOMONAS AERUGINOSA
    Expression System PlasmidPJSM202
    Expression System StrainPAK
    Expression System Taxid1009714
    GeneFIMA
    Organism ScientificDICHELOBACTER NODOSUS
    Organism Taxid870
    Synonym198 ANTIGEN, PILIN, SEROGROUP A1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3SOK)

(-) Sites  (0, 0)

(no "Site" information available for 3SOK)

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:56 -A:97
2B:56 -B:97

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3SOK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3SOK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3SOK)

(-) Exons   (0, 0)

(no "Exon" information available for 3SOK)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:151
 aligned with FMAA_DICNO | P02975 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:151
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157 
           FMAA_DICNO     8 FTLIELMIVVAIIGILAAFAIPAYNDYIARSQAAEGLTLADGLKVRISDHLESGECKGDANPASGSLGNDDKGKYALATIDGDYNKDAKTADEKNGCKVVITYGQGTAGEKISKLIVGKKLVLDQFVNGSYKYNEGETDLELKFIPNAVKN 158
               SCOP domains d3soka_ A: automated matches                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................eee...eeeeeee...........eeeeeeeeee................eeeeeee....eee.......hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sok A   1 FTLIELMIVVAIIGILAAFAIPAYNDYIARSQAAEGLTLADGLKVRISDHLESGECKGDANPASGSLGNDDKGKYALATIDGDYNKDAKTADEKNGCKVVITYGQGTAGEKISKLIVGKKLVLDQFVNGSYKYNEGETDLELKFIPNAVKN 151
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150 

Chain B from PDB  Type:PROTEIN  Length:142
 aligned with FMAA_DICNO | P02975 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:151
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157 
           FMAA_DICNO     8 FTLIELMIVVAIIGILAAFAIPAYNDYIARSQAAEGLTLADGLKVRISDHLESGECKGDANPASGSLGNDDKGKYALATIDGDYNKDAKTADEKNGCKVVITYGQGTAGEKISKLIVGKKLVLDQFVNGSYKYNEGETDLELKFIPNAVKN 158
               SCOP domains d3sokb_ B: automated matches                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......---------..eee...eeeeeee...........eeeeeeeeee................eeeeeee....eee.......hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sok B   1 FTLIELMIVVAIIGILAAFAIPAYNDYIARSQAAEGLTLADGLKVRISDHLESGECKG---------GNDDKGKYALATIDGDYNKDAKTADEKNGCKVVITYGQGTAGEKISKLIVGKKLVLDQFVNGSYKYNEGETDLELKFIPNAVKN 151
                                    10        20        30        40        50       | -       |70        80        90       100       110       120       130       140       150 
                                                                                    58        68                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3SOK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3SOK)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (FMAA_DICNO | P02975)
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
cellular component
    GO:0009289    pilus    A proteinaceous hair-like appendage on the surface of bacteria ranging from 2-8 nm in diameter.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3sok)
 
  Sites
(no "Sites" information available for 3sok)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3sok)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3sok
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FMAA_DICNO | P02975
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FMAA_DICNO | P02975
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3SOK)

(-) Related Entries Specified in the PDB File

3soj