Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  A NEW N-ACETYLTRANSFERASE FOLD IN THE STRUCTURE AND MECHANISM OF THE PHOSPHONATE BIOSYNTHETIC ENZYME FRBF
 
Authors :  B. Bae, S. K. Nair
Date :  27 Jun 11  (Deposition) - 24 Aug 11  (Release) - 26 Oct 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C (1x),D (1x)
Keywords :  N-Acetyl Transferase, Acetyl Coa Binding, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Bae, R. E. Cobb, M. A. Desieno, H. Zhao, S. K. Nair
New N-Acetyltransferase Fold In The Structure And Mechanism Of The Phosphonate Biosynthetic Enzyme Frbf.
J. Biol. Chem. V. 286 36132 2011
PubMed-ID: 21865168  |  Reference-DOI: 10.1074/JBC.M111.263533

(-) Compounds

Molecule 1 - FRBF
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: FRBF
    Organism Scientific: STREPTOMYCES RUBELLOMURINUS
    Organism Taxid: 359131

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   C (1x)D (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1ACO4Ligand/IonACETYL COENZYME *A
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1ACO2Ligand/IonACETYL COENZYME *A
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1ACO1Ligand/IonACETYL COENZYME *A

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:19 , HIS A:45 , ALA A:46 , SER A:47 , LEU A:48 , SER A:49 , GLY A:52 , VAL A:54 , GLY A:57 , PRO A:78 , PHE A:80 , GLY A:119 , MET A:120 , GLY A:121 , ALA A:122 , CYS A:184 , GLU A:187 , SER A:188 , THR A:190 , HIS A:193 , GLU A:231 , HOH A:299 , HOH A:318BINDING SITE FOR RESIDUE ACO A 300
2AC2SOFTWAREHIS B:45 , ALA B:46 , SER B:47 , LEU B:48 , SER B:49 , GLY B:52 , VAL B:54 , GLY B:57 , PRO B:78 , PHE B:80 , MET B:120 , GLY B:121 , ALA B:122 , CYS B:184 , GLU B:187 , SER B:188 , THR B:190 , HIS B:193 , GLU B:231 , HOH B:320 , HOH B:342 , HOH B:358 , HOH B:387BINDING SITE FOR RESIDUE ACO B 300
3AC3SOFTWAREHIS C:45 , ALA C:46 , SER C:47 , LEU C:48 , SER C:49 , GLY C:52 , VAL C:54 , GLY C:57 , LYS C:71 , PRO C:78 , GLY C:121 , ALA C:122 , CYS C:184 , GLU C:187 , SER C:188 , THR C:190 , HIS C:193 , HOH C:298 , HOH C:328 , HOH C:362 , HOH C:393BINDING SITE FOR RESIDUE ACO C 300
4AC4SOFTWAREARG D:19 , HIS D:45 , ALA D:46 , SER D:47 , LEU D:48 , SER D:49 , GLY D:52 , VAL D:54 , GLY D:57 , PRO D:78 , MET D:120 , GLY D:121 , ALA D:122 , CYS D:184 , GLU D:187 , SER D:188 , THR D:190 , HIS D:193 , GLU D:231 , HOH D:290 , HOH D:304 , HOH D:423BINDING SITE FOR RESIDUE ACO D 300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3SMA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3SMA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3SMA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3SMA)

(-) Exons   (0, 0)

(no "Exon" information available for 3SMA)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:263
 aligned with Q0ZQ43_9ACTN | Q0ZQ43 from UniProtKB/TrEMBL  Length:286

    Alignment length:263
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278   
         Q0ZQ43_9ACTN    19 RELVTRDRLASDLAALGVRPGGVLLVHASLSALGWVCGGAQAVVLALQDAVGKEGTLVMPTFSGDLSDPSTWRRPPVPEDWWPVIREQMPPFDPDLTPTRGMGAVAECFRRAAGAVRSGHPQNSFAAWGAHAEQVVAEHGLTERLGRGSPLEQVYRLDGQVLLLGCGFESNTSFHLAEYRTAYPGRRSHRRRVPVPEGDRVRWVEQEDIVYFEEDFQTMGESCLTRTPGHSRGTVGEAAAVLYGQRAFVDLACEWMTAHRDLA 281
               SCOP domains d3smaa_ A: automated matches                                                                                                                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eehhhhhhhhhhhhh.....eeeeee......ee.hhhhhhhhhhhhhhh...eeeee.......hhhhh.....hhhhhhhhhhhh.............hhhhhhhh.....ee.......eeeee.hhhhhhh...........hhhhhhhhh..eeeee..hhhhhhhhhhhhhhh......eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhh...eeeee..eeeeeeehhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sma A  19 RELVTRDRLASDLAALGVRPGGVLLVHASLSALGWVCGGAQAVVLALQDAVGKEGTLVMPTFSGDLSDPSTWRRPPVPEDWWPVIREQMPPFDPDLTPTRGMGAVAECFRRAAGAVRSGHPQNSFAAWGAHAEQVVAEHGLTERLGRGSPLEQVYRLDGQVLLLGCGFESNTSFHLAEYRTAYPGRRSHRRRVPVPEGDRVRWVEQEDIVYFEEDFQTMGESCLTRTPGHSRGTVGEAAAVLYGQRAFVDLACEWMTAHRDLA 281
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278   


Chain B from PDB  Type:PROTEIN  Length:268
 aligned with Q0ZQ43_9ACTN | Q0ZQ43 from UniProtKB/TrEMBL  Length:286

    Alignment length:268
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273        
         Q0ZQ43_9ACTN    14 PDRQDRELVTRDRLASDLAALGVRPGGVLLVHASLSALGWVCGGAQAVVLALQDAVGKEGTLVMPTFSGDLSDPSTWRRPPVPEDWWPVIREQMPPFDPDLTPTRGMGAVAECFRRAAGAVRSGHPQNSFAAWGAHAEQVVAEHGLTERLGRGSPLEQVYRLDGQVLLLGCGFESNTSFHLAEYRTAYPGRRSHRRRVPVPEGDRVRWVEQEDIVYFEEDFQTMGESCLTRTPGHSRGTVGEAAAVLYGQRAFVDLACEWMTAHRDLA 281
               SCOP domains d3smab_ B: automated matches                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eehhhhhhhhhhhhh.....eeeeee.hhhhhee.hhhhhhhhhhhhhhh...eeeee.......hhhhh.....hhhhhhhhhhhh.............hhhhhhhh.....ee.......eeeee.hhhhhhh...........hhhhhhhhh..eeeee..hhhhhhhhhhhhhhh......eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhh....eeeee..eeeeeeehhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sma B  14 PDRQDRELVTRDRLASDLAALGVRPGGVLLVHASLSALGWVCGGAQAVVLALQDAVGKEGTLVMPTFSGDLSDPSTWRRPPVPEDWWPVIREQMPPFDPDLTPTRGMGAVAECFRRAAGAVRSGHPQNSFAAWGAHAEQVVAEHGLTERLGRGSPLEQVYRLDGQVLLLGCGFESNTSFHLAEYRTAYPGRRSHRRRVPVPEGDRVRWVEQEDIVYFEEDFQTMGESCLTRTPGHSRGTVGEAAAVLYGQRAFVDLACEWMTAHRDLA 281
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273        


Chain C from PDB  Type:PROTEIN  Length:262
 aligned with Q0ZQ43_9ACTN | Q0ZQ43 from UniProtKB/TrEMBL  Length:286

    Alignment length:262
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278  
         Q0ZQ43_9ACTN    19 RELVTRDRLASDLAALGVRPGGVLLVHASLSALGWVCGGAQAVVLALQDAVGKEGTLVMPTFSGDLSDPSTWRRPPVPEDWWPVIREQMPPFDPDLTPTRGMGAVAECFRRAAGAVRSGHPQNSFAAWGAHAEQVVAEHGLTERLGRGSPLEQVYRLDGQVLLLGCGFESNTSFHLAEYRTAYPGRRSHRRRVPVPEGDRVRWVEQEDIVYFEEDFQTMGESCLTRTPGHSRGTVGEAAAVLYGQRAFVDLACEWMTAHRDL 280
               SCOP domains d3smac_ C: automated matches                                                                                                                                                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eehhhhhhhhhhhhh.....eeeeee.hhhhhee.hhhhhhhhhhhhhhh...eeeee.......hhhhh.....hhhhhhhhhhhh.............hhhhhhhh.....ee.......eeeee.hhhhhhh...........hhhhhhhhh..eeeee..hhhhhhhhhhhhhhh......eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhh....eeeee..eeeeeeehhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sma C  19 RELVTRDRLASDLAALGVRPGGVLLVHASLSALGWVCGGAQAVVLALQDAVGKEGTLVMPTFSGDLSDPSTWRRPPVPEDWWPVIREQMPPFDPDLTPTRGMGAVAECFRRAAGAVRSGHPQNSFAAWGAHAEQVVAEHGLTERLGRGSPLEQVYRLDGQVLLLGCGFESNTSFHLAEYRTAYPGRRSHRRRVPVPEGDRVRWVEQEDIVYFEEDFQTMGESCLTRTPGHSRGTVGEAAAVLYGQRAFVDLACEWMTAHRDL 280
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278  


Chain D from PDB  Type:PROTEIN  Length:264
 aligned with Q0ZQ43_9ACTN | Q0ZQ43 from UniProtKB/TrEMBL  Length:286

    Alignment length:264
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278    
         Q0ZQ43_9ACTN    19 RELVTRDRLASDLAALGVRPGGVLLVHASLSALGWVCGGAQAVVLALQDAVGKEGTLVMPTFSGDLSDPSTWRRPPVPEDWWPVIREQMPPFDPDLTPTRGMGAVAECFRRAAGAVRSGHPQNSFAAWGAHAEQVVAEHGLTERLGRGSPLEQVYRLDGQVLLLGCGFESNTSFHLAEYRTAYPGRRSHRRRVPVPEGDRVRWVEQEDIVYFEEDFQTMGESCLTRTPGHSRGTVGEAAAVLYGQRAFVDLACEWMTAHRDLAR 282
               SCOP domains d3smad_ D: automated matches                                                                                                                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eehhhhhhhhhhhhh.....eeeeee.hhhhhee.hhhhhhhhhhhhhhh...eeeee.......hhhhh.....hhhhhhhhhhhh.............hhhhhhhh.....ee.......eeeee.hhhhhhh...........hhhhhhhhh..eeeee..hhhhhhhhhhhhhhh......eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhh....eeeee..eeeeeeehhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3sma D  19 RELVTRDRLASDLAALGVRPGGVLLVHASLSALGWVCGGAQAVVLALQDAVGKEGTLVMPTFSGDLSDPSTWRRPPVPEDWWPVIREQMPPFDPDLTPTRGMGAVAECFRRAAGAVRSGHPQNSFAAWGAHAEQVVAEHGLTERLGRGSPLEQVYRLDGQVLLLGCGFESNTSFHLAEYRTAYPGRRSHRRRVPVPEGDRVRWVEQEDIVYFEEDFQTMGESCLTRTPGHSRGTVGEAAAVLYGQRAFVDLACEWMTAHRDLAR 282
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3SMA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3SMA)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q0ZQ43_9ACTN | Q0ZQ43)
molecular function
    GO:0046353    aminoglycoside 3-N-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + aminoglycoside = CoA + 3-N-acetylaminoglycoside. This is acetylation of the 3-amino group of the central deoxystreptamine ring.
biological process
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3sma)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3sma
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0ZQ43_9ACTN | Q0ZQ43
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q0ZQ43_9ACTN | Q0ZQ43
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3SMA)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3SMA)