Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A PUTATIVE TRIOSEPHOSPHATE ISOMERASE FROM COCCIDIOIDES IMMITIS
 
Authors :  Seattle Structural Genomics Center For Infectious Disease (S
Date :  25 May 11  (Deposition) - 22 Jun 11  (Release) - 22 Jun 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Seattle Structural Genomics Center For Infectious Disease, Ssgcid, Pathogenic Fungus, Eukaryote, Tim Barrel, Triosephosphate Isomerase, Tpi, Dihydroxyacetone Phosphate, D-Glyceraldehyde 3-Phosphate, Glycolysis, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. E. Edwards, J. Abendroth, Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal Structure Of A Putative Triosephosphate Isomerase From Coccidioides Immitis
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE TRIOSEPHOSPHATE ISOMERASE
    ChainsA
    EC Number5.3.1.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPAVA0421
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneCIMG_07933
    Organism CommonVALLEY FEVER FUNGUS
    Organism ScientificCOCCIDIOIDES IMMITIS RS
    Organism Taxid246410
    StrainRS
    SynonymTIM, TRIOSE-PHOSPHATE ISOMERASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1NA1Ligand/IonSODIUM ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1NA-1Ligand/IonSODIUM ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:109 , HOH A:359 , HOH A:360BINDING SITE FOR RESIDUE NA A 290

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3S6D)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3S6D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3S6D)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TIM_2PS51440 Triosephosphate isomerase (TIM) family profile.TPIS_COCIM15-283  1A:15-283
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TIM_2PS51440 Triosephosphate isomerase (TIM) family profile.TPIS_COCIM15-283  2A:15-283

(-) Exons   (0, 0)

(no "Exon" information available for 3S6D)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:270
 aligned with TPIS_COCIM | P0CL22 from UniProtKB/Swiss-Prot  Length:289

    Alignment length:281
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287 
           TPIS_COCIM     8 PRFPPLPKTLLIISLKMYFTPSRTIDYIQGLLEPRNDIIRQENRSRLLLALIPDFLTIYPCSEAIKEFESNLAAPQDADTPPPLLLGAQDCFWDSLGPYTGEISPVCLRDMNVSIVELGHAERRAIFGETDQQVARKAAAAADQGLIPLVCIGEVSTLGPIVSEAIGRAVGECEAQIRPVLEALPRDAPVIFAYEPVWAIGKPQPARVDHVGAVVSGIRSVIERIDRHRKGEVRILYGGSAGPGLWGPGGLGKEVDGMFLGRFAHDIEGVRKVVREVEESL 288
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------TIM-3s6dA01 A:16-281                                                                                                                                                                                                                                                      ------- Pfam domains
         Sec.struct. author ........eeeeee.....hhhhhhhhhhhhhhhhhh..hhhhh..eeeeee.hhhhhhhhhhhhhhhhh....------....eeee...............hhhhhhhh...eeee.hhhhhhhhh.hhhhhhhhhhhhhhh..eeeeee........hhhhhhhhhhhhhhhhhhhhhhhh.....eeeee.hhhhh-----.hhhhhhhhhhhhhhhhhhhhh.....eeeeeeeee........hhhhh..eeee.hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------TIM_2  PDB: A:15-283 UniProt: 15-283                                                                                                                                                                                                                                         ----- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3s6d A   8 PRFPPLPKTLLIISLKMYFTPSRTIDYIQGLLEPRNDIIRQENRSRLLLALIPDFLTIYPCSEAIKEFESNLAA------PPPLLLGAQDCFWDSLGPYTGEISPVCLRDMNVSIVELGHAERRAIFGETDQQVARKAAAAADQGLIPLVCIGEVSTLGPIVSEAIGRAVGECEAQIRPVLEALPRDAPVIFAYEPVWAI-----ARVDHVGAVVSGIRSVIERIDRHRKGEVRILYGGSAGPGLWGPGGLGKEVDGMFLGRFAHDIEGVRKVVREVEESL 288
                                    17        27        37        47        57        67        77   |     -|       97       107       117       127       137       147       157       167       177       187       197       207     | 217       227       237       247       257       267       277       287 
                                                                                                    81     88                                                                                                                    207   213                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3S6D)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3S6D)

(-) Pfam Domains  (1, 1)

Asymmetric Unit

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)
Chain A   (TPIS_COCIM | P0CL22)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0004807    triose-phosphate isomerase activity    Catalysis of the reaction: D-glyceraldehyde 3-phosphate = glycerone phosphate.
biological process
    GO:0006094    gluconeogenesis    The formation of glucose from noncarbohydrate precursors, such as pyruvate, amino acids and glycerol.
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0006098    pentose-phosphate shunt    The glucose-6-phosphate catabolic process in which, coupled to NADPH synthesis, glucose-6-P is oxidized with the formation of carbon dioxide (CO2) and ribulose 5-phosphate; ribulose 5-P then enters a series of reactions interconverting sugar phosphates. The pentose phosphate pathway is a major source of reducing equivalents for biosynthesis reactions and is also important for the conversion of hexoses to pentoses.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3s6d)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3s6d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TPIS_COCIM | P0CL22
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.3.1.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TPIS_COCIM | P0CL22
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3S6D)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3S6D)