![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4) Biological Unit 1 (1, 2) Biological Unit 2 (1, 4) |
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 3S2Q) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 3S2Q) |
(no "PROSITE Motif" information available for 3S2Q) |
(no "Exon" information available for 3S2Q) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:65 aligned with NEET_ARATH | Q9FLI7 from UniProtKB/Swiss-Prot Length:108 Alignment length:65 53 63 73 83 93 103 NEET_ARATH 44 GGINPEIRKNEDKVVDSVVVTELSKNITPYCRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLKKQ 108 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 3s2q A 44 GGINPEIRKNEDKVVDSVVVTELSKNITPYCRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLKKQ 108 53 63 73 83 93 103 Chain B from PDB Type:PROTEIN Length:65 aligned with NEET_ARATH | Q9FLI7 from UniProtKB/Swiss-Prot Length:108 Alignment length:65 53 63 73 83 93 103 NEET_ARATH 44 GGINPEIRKNEDKVVDSVVVTELSKNITPYCRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLKKQ 108 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 3s2q B 44 GGINPEIRKNEDKVVDSVVVTELSKNITPYCRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLKKQ 108 53 63 73 83 93 103
|
(no "SCOP Domain" information available for 3S2Q) |
(no "CATH Domain" information available for 3S2Q) |
(no "Pfam Domain" information available for 3S2Q) |
Asymmetric Unit(hide GO term definitions) Chain A,B (NEET_ARATH | Q9FLI7)
|
|
|
|
|
|
|