Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  ACOUSTICALLY MOUNTED PORCINE INSULIN MICROCRYSTALS YIELD AN X-RAY SAD STRUCTURE
 
Authors :  A. S. Soares, M. A. Engel, R. Stearns, S. Datwani, J. Olechno, R. Ellson, J. M. Skinner, M. Allaire, A. M. Orville
Date :  03 May 11  (Deposition) - 18 May 11  (Release) - 08 Jun 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (3x)
Keywords :  Hormone (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. S. Soares, M. A. Engel, R. Stearns, S. Datwani, J. Olechno, R. Ellson J. M. Skinner, M. Allaire, A. M. Orville
Acoustically Mounted Microcrystals Yield High-Resolution X-Ray Structures.
Biochemistry V. 50 4399 2011
PubMed-ID: 21542590  |  Reference-DOI: 10.1021/BI200549X

(-) Compounds

Molecule 1 - INSULIN
    ChainsA, C
    FragmentINSULIN A CHAIN (UNP RESIDUES 88-108)
    Organism CommonPIG
    Organism ScientificSUS SCROFA
    Organism Taxid9823
 
Molecule 2 - INSULIN
    ChainsB, D
    FragmentINSULIN B CHAIN (UNP RESIDUES 25-54)
    Organism CommonPIG
    Organism ScientificSUS SCROFA
    Organism Taxid9823

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (3x)ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1ZN2Ligand/IonZINC ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1ZN-1Ligand/IonZINC ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS B:10 , HOH B:36BINDING SITE FOR RESIDUE ZN B 31
2AC2SOFTWAREHIS D:10 , HOH D:32BINDING SITE FOR RESIDUE ZN D 31

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:6 -A:11
2A:7 -B:7
3A:20 -B:19
4C:6 -C:11
5C:7 -D:7
6C:20 -D:19

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3RTO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3RTO)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1INSULINPS00262 Insulin family signature.INS_PIG93-107
 
  2A:6-20
C:6-20
Biological Unit 1 (1, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1INSULINPS00262 Insulin family signature.INS_PIG93-107
 
  6A:6-20
C:6-20

(-) Exons   (0, 0)

(no "Exon" information available for 3RTO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:21
 aligned with INS_PIG | P01315 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:21
                                    97       107 
              INS_PIG    88 GIVEQCCTSICSLYQLENYCN 108
               SCOP domains --------------------- SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains --------------------- Pfam domains
         Sec.struct. author hhhhhhhhh..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE -----INSULIN        - PROSITE
                 Transcript --------------------- Transcript
                 3rto A   1 GIVEQCCTSICSLYQLENYCN  21
                                    10        20 

Chain B from PDB  Type:PROTEIN  Length:30
 aligned with INS_PIG | P01315 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:30
                                    34        44        54
              INS_PIG    25 FVNQHLCGSHLVEALYLVCGERGFFYTPKA  54
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhheee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 3rto B   1 FVNQHLCGSHLVEALYLVCGERGFFYTPKA  30
                                    10        20        30

Chain C from PDB  Type:PROTEIN  Length:21
 aligned with INS_PIG | P01315 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:21
                                    97       107 
              INS_PIG    88 GIVEQCCTSICSLYQLENYCN 108
               SCOP domains --------------------- SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains --------------------- Pfam domains
         Sec.struct. author hhhhhhh....hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE -----INSULIN        - PROSITE
                 Transcript --------------------- Transcript
                 3rto C   1 GIVEQCCTSICSLYQLENYCN  21
                                    10        20 

Chain D from PDB  Type:PROTEIN  Length:30
 aligned with INS_PIG | P01315 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:30
                                    34        44        54
              INS_PIG    25 FVNQHLCGSHLVEALYLVCGERGFFYTPKA  54
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
           Pfam domains (1) ---Insulin-3rtoD01 D:4-30      Pfam domains (1)
           Pfam domains (2) ---Insulin-3rtoD02 D:4-30      Pfam domains (2)
           Pfam domains (3) ---Insulin-3rtoD03 D:4-30      Pfam domains (3)
           Pfam domains (4) ---Insulin-3rtoD04 D:4-30      Pfam domains (4)
         Sec.struct. author .......hhhhhhhhhhhhhhhheee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 3rto D   1 FVNQHLCGSHLVEALYLVCGERGFFYTPKA  30
                                    10        20        30

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3RTO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3RTO)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: Insulin (93)

(-) Gene Ontology  (18, 18)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (INS_PIG | P01315)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005159    insulin-like growth factor receptor binding    Interacting selectively and non-covalently with the insulin-like growth factor receptor.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0006006    glucose metabolic process    The chemical reactions and pathways involving glucose, the aldohexose gluco-hexose. D-glucose is dextrorotatory and is sometimes known as dextrose; it is an important source of energy for living organisms and is found free as well as combined in homo- and hetero-oligosaccharides and polysaccharides.
    GO:0009101    glycoprotein biosynthetic process    The chemical reactions and pathways resulting in the formation of glycoproteins, any protein that contains covalently bound glycose (i.e. monosaccharide) residues; the glycose occurs most commonly as oligosaccharide or fairly small polysaccharide but occasionally as monosaccharide.
    GO:0019249    lactate biosynthetic process    The chemical reactions and pathways resulting in the formation of lactate, the anion of lactic acid.
    GO:0008610    lipid biosynthetic process    The chemical reactions and pathways resulting in the formation of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0042158    lipoprotein biosynthetic process    The chemical reactions and pathways resulting in the formation of any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0045721    negative regulation of gluconeogenesis    Any process that stops, prevents, or reduces the frequency, rate or extent of gluconeogenesis.
    GO:0045740    positive regulation of DNA replication    Any process that activates or increases the frequency, rate or extent of DNA replication.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0046628    positive regulation of insulin receptor signaling pathway    Any process that increases the frequency, rate or extent of insulin receptor signaling.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0031954    positive regulation of protein autophosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation by a protein of one or more of its own residues.
    GO:1903576    response to L-arginine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a L-arginine stimulus.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3rto)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3rto
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  INS_PIG | P01315
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  INS_PIG | P01315
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        INS_PIG | P013151b17 1b18 1b19 1b2a 1b2b 1b2c 1b2d 1b2e 1b2f 1b2g 1dei 1iza 1izb 1m5a 1mpj 1sdb 1wav 1zei 1zni 2efa 2g4m 2tci 2zpp 3fhp 3gky 3ins 3mth 3t2a 4a7e 4ins 5d52 5d53 5d54 5d5e 5fb6 5lis 6ins 7ins 9ins

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3RTO)